SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000000603 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000000603
Domain Number 1 Region: 41-139
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.31e-31
Family Ubiquitin-related 0.00000272
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000000603   Gene: ENSTTRG00000000642   Transcript: ENSTTRT00000000642
Sequence length 142
Comment pep:novel scaffold:turTru1:scaffold_115493:184242:211999:-1 gene:ENSTTRG00000000642 transcript:ENSTTRT00000000642 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RKCLPPRCCAVGKGDGFVNPGARFCLPEAAAVRRPGETTVTMSDQEAKPSTEDLGDKKEG
EYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKE
LGMEEEDVIEVYQEQTGGRSTI
Download sequence
Identical sequences ENSTTRP00000000603 ENSTTRP00000000603

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]