SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000000643 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000000643
Domain Number 1 Region: 237-482
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.4e-83
Family Eukaryotic proteases 0.00014
Further Details:      
 
Domain Number 2 Region: 139-239
Classification Level Classification E-value
Superfamily SRCR-like 1.31e-19
Family Hepsin, N-terminal domain 0.042
Further Details:      
 
Domain Number 3 Region: 111-142
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000113
Family LDL receptor-like module 0.0032
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000000643
Domain Number - Region: 7-64
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0214
Family beta-sandwich domain of Sec23/24 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000000643   Gene: ENSTTRG00000000684   Transcript: ENSTTRT00000000684
Sequence length 486
Comment pep:novel genescaffold:turTru1:GeneScaffold_3080:122283:143538:-1 gene:ENSTTRG00000000684 transcript:ENSTTRT00000000684 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GSPPDVGPYYENHGFQPESLYPPQPPMAHRAYAGYPAQYYPPAVPQYAPRVQTHTSTPVI
LMQPKPPSGPACTSRTKKVLCVTFSLGALLAGAVLAAMLLWKLMEDECLGMECSSSGTCV
SPSHWCDGILHCPSGEDESRCVRLYGPNFILQVYSAQRKSWHPVCQDDWSDNYGRAACQD
MGYPNSFFSSQGIVDDSGATSFMKLNVSANNIDLYKKLYHSDVCSSKTVVSLRCIECGVS
GKTRRQSRIVGGSSAAPGDWPWQVSLHVQGTHVCGGSIITPEWIVTAAHCVEEPLNNPKI
WTAFAGILRQSFMFYGNGYRVAKVISHPNYDSKTKNNDIALMKLQTPLTFNDRVKPVCLP
NPGMMLEPTQACWISGWGSTYEKGKTSDRLNAAMVQLIEPWRCDSKQVYSDLITPAMICA
GYLQGTVDSCQGDSGGPLVTLKSSVWWLIGDTSWGSGCAKAYRPGVYGNVTVFTDWIYRQ
MRAGGL
Download sequence
Identical sequences ENSTTRP00000000643 ENSTTRP00000000643

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]