SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000000652 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000000652
Domain Number 1 Region: 346-402
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1e-25
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 2 Region: 457-514
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.4e-24
Family Classic zinc finger, C2H2 0.0033
Further Details:      
 
Domain Number 3 Region: 401-458
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.07e-24
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 4 Region: 261-318
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.15e-21
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 5 Region: 513-565
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.34e-21
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 
Domain Number 6 Region: 26-81
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.4e-20
Family KRAB domain (Kruppel-associated box) 0.0019
Further Details:      
 
Domain Number 7 Region: 224-275
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000728
Family Classic zinc finger, C2H2 0.023
Further Details:      
 
Domain Number 8 Region: 309-339
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000596
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000000652
Domain Number - Region: 178-221
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0202
Family Classic zinc finger, C2H2 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000000652   Gene: ENSTTRG00000000692   Transcript: ENSTTRT00000000693
Sequence length 571
Comment pep:novel scaffold:turTru1:scaffold_91177:33898:40290:1 gene:ENSTTRG00000000692 transcript:ENSTTRT00000000693 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HASQTPLRPQTPMAAAAALRDPPQGMKFEDVAIDFSQEEWGLLDEAQRLLYYNVMLENFA
LVASLGCCHGTEDEETPSEQSISVEGESQVRASKAGPSTQKTHPCEMCVPILKDILQQAE
HQRVYPLQKPDLGGTYVRCFCFIANLRQQQKHDSGEKPWKRDVDRASLVRSCNFFVPGKP
FTCGEVGEDFPATLGLLQHQATPNSEEIQSGSKSGQAFHSEKSHYKWGECEKVVSHSHTL
VQDKSVHSKEGLYECNRCRRAFNCNYRLVQHQQIHTGQRPYECGECGKFFSQQWYLVLHQ
KIHTGERTYECSECGKVFSHKSKLIHHQRQHTGGMHFECGECGKFFSYKSNLIEHQRVHT
KERPYECSECGKSFRQSSSLFRHQRVHTGERPYECSECGKAFRQIFNLIRHGRVHTGEMP
YECSECGKSFSCKSELVQHQRIHSGERPYVCSECGKSFRQFSNLIRHRSVHTGERPYECS
VCGKSFSRKFILIQHQRVHTGERPYECTECGKSFTRKSDLIQHQRIHTVTRPYECSECGK
SFRQRSGLIQHRRIHSGEKPYECGEMWGNPF
Download sequence
Identical sequences ENSTTRP00000000652 ENSTTRP00000000652

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]