SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000000765 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000000765
Domain Number 1 Region: 100-184
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.09e-19
Family APG12-like 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000000765   Gene: ENSTTRG00000000812   Transcript: ENSTTRT00000000812
Sequence length 185
Comment pep:novel genescaffold:turTru1:GeneScaffold_1213:74968:92674:-1 gene:ENSTTRG00000000812 transcript:ENSTTRT00000000812 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RTNLQFRLSVVVWVPLLRHLPSAALRRKARPLYALSHHFRPHLPPSKMAEEPESSLQLPP
SIAAEGEGPTEVSPETATPEPPSSAAVSPGTEEPAGDTKKKIDILLMAVGDTPIMKTKKW
AVRTRTIQGLIDFIKKFLKLVASEQLLIVNQSFAPSPDQEVGTLYECFGSDGKLVLHYCK
SQAWG
Download sequence
Identical sequences ENSTTRP00000000765 ENSTTRP00000000765

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]