SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000000991 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000000991
Domain Number 1 Region: 176-284
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 0.00000000000118
Family Ypt/Rab-GAP domain of gyp1p 0.013
Further Details:      
 
Domain Number 2 Region: 31-89
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 0.0000175
Family Ypt/Rab-GAP domain of gyp1p 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000000991   Gene: ENSTTRG00000001053   Transcript: ENSTTRT00000001054
Sequence length 293
Comment pep:novel genescaffold:turTru1:GeneScaffold_820:763143:780807:-1 gene:ENSTTRG00000001053 transcript:ENSTTRT00000001054 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTEDSQRNFRSVYYEKVGFRGVEEKKSLEILLKDDCLDIEKLCTFSQRFPLPSMYRALVW
KVLLGILPPHHESHAQVMMYRKEQYSDVLHALEVIRFISDATPQVEVYLYMHRLESGKLP
RSPSFALEPEDEVFLAIAKAMEEMVEDSIDCYWLTRCFVNQLNNKYRDFLPQLPKAFEQY
LNLEDSRLLSHLKTSSAVSKLPYDLWFKRCFAGCLPESSLQRVWDKVISGSCKILVFVAV
EILLTFKIKVMALNGAEKITKFLENIPQDSSDAIVSKAIDLWHKHCGTPVHSA
Download sequence
Identical sequences ENSTTRP00000000991 XP_004326716.2.83887 XP_012389822.1.21590 XP_019800562.1.83887 XP_019800563.1.83887 XP_019800564.1.83887 ENSTTRP00000000991

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]