SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000001064 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000001064
Domain Number 1 Region: 820-877
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.55e-25
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 2 Region: 767-821
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.09e-22
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 3 Region: 652-709
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.69e-18
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 4 Region: 614-666
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.57e-17
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 5 Region: 862-914
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000436
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 6 Region: 52-108
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.000000000000379
Family KRAB domain (Kruppel-associated box) 0.003
Further Details:      
 
Domain Number 7 Region: 708-763
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000062
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 8 Region: 258-291
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000101
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 9 Region: 403-454
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000161
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 10 Region: 305-351
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000285
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000001064
Domain Number - Region: 376-415
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000353
Family Classic zinc finger, C2H2 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000001064   Gene: ENSTTRG00000001130   Transcript: ENSTTRT00000001133
Sequence length 924
Comment pep:novel genescaffold:turTru1:GeneScaffold_2572:80174:93190:1 gene:ENSTTRG00000001130 transcript:ENSTTRT00000001133 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PGPQSRGRLMFLLLLLLEVLGAPQRGVSPRRKGHFLRRGSLMEDSAAGPALAMTEEFATL
EDVAMDFTLEDWEQLGLDQGDLFWDTALDNYQNLFLLNSPRPNLTSHPDDGEELAALAKG
SPESTGPDTAEAKTSPLPQDFLDEGIFQEITEMFSKDGLWNSHLEEAYIDQSWLDSLLGD
PESLLKSDIVTSKESPTECKSQELESHKLKRGLGPKSLPFPGAGSVTPDLPERSLTPAKS
QESGNDFGCYSDQSQQDNIQGGEKPYKCGQCEKSFSQSYHLIQHWILHTREDPTVPQENE
KDVNQSSCLFVQPVSHTGSKSYVGNKCGKTSSQNTYLLWHQNIHSEEEPCKSQDSDGPAG
QDSQPVECHKPPPGGKSDKCNEYGESSAKPFHLTRYQKTHTRKLYECARCKAIFNFNKYL
LQHQKIHAAEKTAVCHECGKAFRRSSLLVHQSVHTGKPYCDECKRFSHILTLXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXNPEHREKRFKCNKCEKTFSCSKYLTQHERIHVRVKPFECNQCGKAFSQSSQLI
RHQRIHSGVRPYECRDCGMAFVHSASLAKHQSTHKSEHPFQCNKSGKTFSQSACLSEHQL
IQTAEEPFKPNKCDEVFAYSNHLVQHQGTQAGKKPFEQNECGKTSQQSSCLSKHQRIHTG
EKPYECGDCGKTFNLGAQLIRHRRIHTGEKPYVCQECGKAFSQSSCFSKHQRVHTGEKPY
ECGECGKAFTQKANLMQHQRTHTGEKPYACDVCGKAFGLRAHLSQHQRIHTKEKPHQCPH
CQKALCCCLGLSRHQVHSRQFCPW
Download sequence
Identical sequences ENSTTRP00000001064 ENSTTRP00000001064

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]