SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000001076 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000001076
Domain Number 1 Region: 1858-1932
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.61e-36
Family Classic zinc finger, C2H2 0.0000342
Further Details:      
 
Domain Number 2 Region: 2023-2072
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000489
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 3 Region: 2285-2333
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000182
Family Classic zinc finger, C2H2 0.024
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000001076
Domain Number - Region: 2177-2224
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00136
Family Classic zinc finger, C2H2 0.029
Further Details:      
 
Domain Number - Region: 2395-2421
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00234
Family Classic zinc finger, C2H2 0.026
Further Details:      
 
Domain Number - Region: 1451-1476
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00318
Family Classic zinc finger, C2H2 0.034
Further Details:      
 
Domain Number - Region: 105-132
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0063
Family Classic zinc finger, C2H2 0.049
Further Details:      
 
Domain Number - Region: 536-591
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.00654
Family beta-sandwich domain of Sec23/24 0.038
Further Details:      
 
Domain Number - Region: 582-606,821-845
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00948
Family Classic zinc finger, C2H2 0.021
Further Details:      
 
Domain Number - Region: 2067-2091
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0143
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number - Region: 439-493
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.017
Family Classic zinc finger, C2H2 0.025
Further Details:      
 
Domain Number - Region: 867-898
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0265
Family Classic zinc finger, C2H2 0.045
Further Details:      
 
Domain Number - Region: 1292-1319
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0596
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number - Region: 1087-1128
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0615
Family Classic zinc finger, C2H2 0.035
Further Details:      
 
Domain Number - Region: 1643-1668
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0715
Family Classic zinc finger, C2H2 0.025
Further Details:      
 
Domain Number - Region: 162-187
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.074
Family Classic zinc finger, C2H2 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000001076   Gene: ENSTTRG00000001146   Transcript: ENSTTRT00000001146
Sequence length 2491
Comment pep:novel scaffold:turTru1:scaffold_108540:89719:175030:1 gene:ENSTTRG00000001146 transcript:ENSTTRT00000001146 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVLQCDGCDFRAPSYEDLKAHIQDVHTAFLQPTDVAEDNANEPRSGSMNASNQTEVEFS
SIKDEFVIAEDLSGQNATALGTGSYYGHSPGYYGQHIASNPKPTSKFFQCKFCVRYFRSK
NLLIEHTRKVHGAQAEGSSAGPPVPGSLNYNIMMHEGFGKVFSCQFCTYKSPRRARIIKH
QKMYHKNNLKETTAPPPAPAPMPDPVVPPVSLQDPCKELPAEVVERSILESMVKPLTKSR
GNFCCEWCSYQTPRRERWCDHMMKKHRSMVKILSSLRQQQEGTNLPDVQNKNAPSPTSNS
TYLSVNAASRELPNTNVSTFRGSIGNSIMRPNSSSASKFSPMSYPQMKPKSPHNSGLVSL
AERSRYGMTDMTNSSADLETNSMLNDSSSDEELNEIDSENGLTALDHQTAGMSAEQLMGS
EGNKLLETKGIPFRRFMNRFQCPFCPFLTMHRRSISRHIENIHLSGKTAVYKCDECPFTC
KSSLKLGAHKQCHTGTTSDWDAVNSQSESIASPLHEGVVSYESSSINGRKSGVVLEPLQQ
QQPPPPPPPPPPPSQPQPPQLQPPHQVPPPPPPPAQAPPLHPYKCTMCNYSTTTLKGLRV
HQQHKHSFCDNLPKFEGQPSSLPADGETDSHPSSSNTVKKSQTSILGLSSKNNFVAKASR
KLANDFPLDLSPVKKRTRIDEIASNLQSRINQTKQQEDAVINVEDDEEEEEDNEVEIEVE
LDREEEPPEPILEVPTSFSAQQIWARDAPEPQKEPSFRTVTHDYNATNGAEIELTLSEDE
EDYYGSSTNMKDHQVSSAALLNTQTPIYGTEHGNENADFSDSGRLYYCKHCDFNNKSARS
VSTHYQRMHPYIKFSFRYILDPNDHSAVYRCLECYIDYTNFEDLQQHYGEHHPEAMNVLN
FDHSDLIYRCRFCSYTSPNVRSLMPHYQRMHPTVKINNAMIFSSYVVEQQEGPNTESQTL
REILNSAPKNMAASAAVARGGGVPAPFPKNTPSKTFPPECENQKDPSVSTVVVYDCDVCS
FASPNMHSVLVHYQKKHPEEKASYFMIQKTMRMVSVDRGSALSRLSFEGAPVSPKISAMG
SPPPPPPPPPDLGTELYYCKHCSYSNRSVVGVLVHYQKRHPEIKVTAKYIRQAPPTAAMT
RGADGPQGSPRAPAPRQQLSRSGSERDGPPAESEMFFCQHCDYGNRTVKGVLIHYQKKHR
DFKANADVIRQHTATIRSLCDRNQKKPAGCVLVPPSNVERDRTKLRALKCRQCSYTSPYF
YALRKHIKKDHPALKATVTSIMRWAFLDGLIEAGYHCEWCIYSHTDPNGLLLHYQRRHPE
HYVDYTYMATKLWAGPDPSPPSLTMPAEAKTYRCRDCVFEAVSIWDITNHYQAFHPWAMN
GDESVLLDIIKEKDAVENPIPAPEELVGPVNCENSMPAPLPEQEADCPEDARLSPEKSLQ
LASANPAISSTPYQCTVCQSEYNNLHGLLTHYGKKHPGMKVKAADFAQDIDINPGAVYKC
RHCPYINTRIHGVLTHYQKRHPSIKVTAEDFVHDVEQSADIAQNDVEETSRIFKQGYGAY
RCKLCPYTHGTLEKLKIHYEKYHNQPEFDVFSQSPPKLPVTLEPEITTEVSPSQVSVTED
EVGEEPVSTSHFATSHLVSHTVFRCQLCKYFCSTRKGIARHYRIKHNNVRAQPEGKNNLF
KCALCAYTNPIRKGLAAHYQKRHDIDAYYTHCLAASRTISDKPNKVIIPSPPKDDSPQLS
EELRRAVEKKKCSLCPFQSFSKKGIVSHYMKRHPGVFPKKQHASKLGGYFTAVYADEHEK
PVLMEEEERGGFEKAEVEGSEGQEIEWLPFRCIKCFKLSFSTAELLCMHYTDHHSRDLKR
DFVILGGGPRPQSSAYQCKHCDSKLQSTAELTSHLSIHNEEFQKRAKRQERRKQLLSKQK
YADGAFADFKQERPFGHLEEVPKIKERKVVGYKCKFCVEVHPTLRAICNHLRKHVQYGSV
PAVSAAVKGLRSHERXXXXXXXXXXXXXXXXXXXXXXXXXXXXLDRHMQTHHGHHKPFRC
KLCSFKSSYNSRLKTHILKAHAGEHAYKCSWCAFSTMTISQLKEHSLKVHGKALTLPRPR
IVSLLSSHAHHSSSQKATPAEEVEDSNDSSYSEPPDVQQQLNHYQSAALARNNSRVSPVP
LSGAAGGTEQKTEAVLHCEFCEFSSGYIQSIRRHYRDKHGGKKLFKCKDCSFYTGFKSAF
TMHVEAGHSAVPEEGPKDLRCPLCLYHTKYKRNMIDHIVLHREERVVPIEVCRSKLSKYL
QGVVFRCDKCTFTCSSDESLQQHIEKHNELKPYKCQLCYYETKHTEELDSHLRDEHKVSR
NFELVGRVNLDQLEQMKEKMESSSSDEEDKEEEMNSKADGRDLMRFSDRGAAINTEKRFP
CEFCGRAFSQGSEWERHVLRHGMALNDTKLVSQEEIHLKDSMEDSIKVPSIEEKEDDEAI
GIDFSLKNEPVAICVVAADKSLLENAEAKKE
Download sequence
Identical sequences ENSTTRP00000001076 ENSTTRP00000001076

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]