SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000001329 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000001329
Domain Number 1 Region: 346-403
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.37e-26
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 2 Region: 290-347
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.53e-25
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 3 Region: 234-291
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.77e-23
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 4 Region: 27-78
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 7.98e-21
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 5 Region: 388-440
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.39e-19
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 6 Region: 178-235
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000873
Family Classic zinc finger, C2H2 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000001329   Gene: ENSTTRG00000001412   Transcript: ENSTTRT00000001412
Sequence length 445
Comment pep:novel scaffold:turTru1:scaffold_105570:20457:50195:-1 gene:ENSTTRG00000001412 transcript:ENSTTRT00000001412 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ASALYRGALPFSRRGTQRRSFSANIKAMAQESVMFSDVSIDFSQEEWEYLNDDQRDLYRE
VMLENYSNLVSMGHSISXXXXXXXXXXXXXXXXXDRELTRDQWPVLESRCETKKLFLKKE
IYEIESAQWEIMERLTRHDLQCSSFRDDWECNGQFEKQHGSQEGHFSQLIFTHEGMPTFS
QHPSFTLQQIISNKEKYCATKEYRKSFRHDSQLTTHQIIHTVEKPYECKECGKAFRHPSR
LSHHQKIHTGKKPFECKECGKTFICGSDLTRHHRIHTGEKPYECKECGKAFSSGSNFTRH
QRIHTGEKPYECKECGKAFSSGSNFTQHQRIHTGEKPYECKECGNAFSQSSQLIKHQRIH
TGEKPYECKECEKAFRSGSDLTRHQRIHTGEKPYECKICGKAYSQSSQLISHHRIHTSEK
PYEYRECGKTFNYDSQLIQHQNLYW
Download sequence
Identical sequences ENSTTRP00000001329 ENSTTRP00000001329

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]