SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000001336 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000001336
Domain Number 1 Region: 254-310
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.97e-25
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 2 Region: 197-254
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.59e-23
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 3 Region: 159-211
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.72e-20
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 4 Region: 8-55
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 7.06e-19
Family KRAB domain (Kruppel-associated box) 0.0017
Further Details:      
 
Domain Number 5 Region: 309-365
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.83e-17
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 6 Region: 354-410
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000468
Family Classic zinc finger, C2H2 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000001336   Gene: ENSTTRG00000001420   Transcript: ENSTTRT00000001419
Sequence length 454
Comment pep:novel genescaffold:turTru1:GeneScaffold_3638:59878:68385:-1 gene:ENSTTRG00000001420 transcript:ENSTTRT00000001419 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVMPLRAWHQEVVTFEDVAIYFTQTEWAGLSPAQRALYRSVMLEIYGNLTSLXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAGTNTDNELTPTWGVSEERDMMMLHGPQ
KNVLKRNSFLETCELEKHQEIPTVKNIRGKVPRIHYNRKPFRCEECGKCFSYFSYYVRHQ
RIHTGEKPFECNECGKAFNGNSSLIRHQRIHTGEKPYQCEECGRAFNDNANLIRHQRIHS
GDRPYLCTECGNGFTSSSEFVIHQRIHTGEKPYECNECGKAFIGNSPLLRHQKIHTGEKP
YECNECGKSFGRTSHLSQHQRIHTGEKPYCKICGQAFNFHTKLNRHQRVHSEVKPFDCVD
CGKAFSAQDQLKRHLRIHIQETSCVCDECGIVLTSKRNLLQHQRVHTREKTCEYVKYEKT
FRTSSQLDHIHPGEKPVLDVGCFGLPEFFTPFYW
Download sequence
Identical sequences ENSTTRP00000001336 ENSTTRP00000001336

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]