SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000001453 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000001453
Domain Number 1 Region: 74-267
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 1.57e-51
Family CRAL/TRIO domain 0.000000107
Further Details:      
 
Domain Number 2 Region: 272-382
Classification Level Classification E-value
Superfamily Supernatant protein factor (SPF), C-terminal domain 3.53e-32
Family Supernatant protein factor (SPF), C-terminal domain 0.00000273
Further Details:      
 
Domain Number 3 Region: 2-71
Classification Level Classification E-value
Superfamily CRAL/TRIO N-terminal domain 0.00000000000222
Family CRAL/TRIO N-terminal domain 0.0000391
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000001453   Gene: ENSTTRG00000001540   Transcript: ENSTTRT00000001540
Sequence length 394
Comment pep:novel genescaffold:turTru1:GeneScaffold_496:426008:435109:-1 gene:ENSTTRG00000001540 transcript:ENSTTRT00000001540 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGRVGDLSPKQAETLAKFENVQDVLPALPNPDDYFLLRWLAQNFDLQKSEAMFHKYMEF
RKTMDIDHIDWQPPEVIQKYMPGALCGCDHVGCPVWYDIVGLLDPKGLLFSVTKQDLLKT
KMRDCEGILHKCDLQTLGRKIETIVMIFDCEGLGLKHFWKPLVEVYQEFFGLLEENYPET
LKFMLIVKATKLFPVGYNLMKPFLSEDTHRKIIMLGNSWKEGLLKLISPEELPAQFGGTL
TNPDGNPKYLTKIKCGGEIPKSMYVQDQVKTQYEHLVQISRGSSHQVEYEILFPGCVLRW
QFSSDSEDIGFGVFLKTTMGEWQWAGLMTEVQLNQRYNAHLVPEDGRLTCTEAGVYVLRF
DNTYSFVHTKKVSFTVVLLLDEGMQKDKELTPVW
Download sequence
Identical sequences ENSTTRP00000001453 ENSTTRP00000001453

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]