SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000001474 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000001474
Domain Number 1 Region: 452-509
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.14e-20
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 2 Region: 398-453
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.16e-19
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 3 Region: 317-371
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.5e-18
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 4 Region: 2-46
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.19e-16
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 
Domain Number 5 Region: 494-542
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.76e-16
Family Classic zinc finger, C2H2 0.0083
Further Details:      
 
Domain Number 6 Region: 234-285
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000171
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 7 Region: 361-392
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000177
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000001474
Domain Number - Region: 158-204
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000559
Family Classic zinc finger, C2H2 0.029
Further Details:      
 
Domain Number - Region: 193-234
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0224
Family Classic zinc finger, C2H2 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000001474   Gene: ENSTTRG00000001564   Transcript: ENSTTRT00000001564
Sequence length 577
Comment pep:novel scaffold:turTru1:scaffold_98826:10357:14089:1 gene:ENSTTRG00000001564 transcript:ENSTTRT00000001564 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ETVTFKDVAVVFTEEELALLDSTQINLYQDVMLENFRNLVSVGDRIKNNISNLQEKGLSY
LSPEALYFWQIWKRRISELSVSQGYVMHLQGDCPQYLEGDVSLCEEWAEVSENERYVINA
INLENQDITARKGLAQVLTPESWKKANIMIEPENSQGRHKRIHMEEKLDGCAQCDGIFFQ
TSRDCNDFQECKGEEPYRYTGCGKHLVMKSAVKHSHVVYAVRQPFSCNNYRMGFIDDANA
HVHHSAHTGEKSCKYDQCGKDFSQSSGLTVHYNTHSGEKTCEGQEWAKGCKQSSDLPRNQ
KGPLGDKPYKGIECGKRSSSLHNHHRVHTGEMPYTCDMCGKGFGFRSLLCIHQGVHTGKR
PYKCTECGKGFDQSSRLLVHQRVHTGEKYKCSKCSKCFGSSSVLQVHWRLHMGEKPYRCG
KCGKGFSQSTHLHIHQVHTGEKPYKCDVCRKAFSYSSFLHTHRRVHTGEKPYMCQVCGKD
FSYSSYFHLHQRDHTREKPHACDECGKVFIRNSDLHVHLRVRTGERPCKCKECGKGFGRN
SSSARQTAHRDEMDYACHEPGKDLRTQPRLHKRTETL
Download sequence
Identical sequences ENSTTRP00000001474 ENSTTRP00000001474

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]