SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000001483 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000001483
Domain Number 1 Region: 213-250,337-413
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.81e-19
Family UBX domain 0.036
Further Details:      
 
Domain Number 2 Region: 1-50
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.97e-17
Family UBX domain 0.00014
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000001483
Domain Number - Region: 48-135
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00167
Family UBX domain 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000001483   Gene: ENSTTRG00000001575   Transcript: ENSTTRT00000001575
Sequence length 505
Comment pep:novel genescaffold:turTru1:GeneScaffold_2598:16600:49893:1 gene:ENSTTRG00000001575 transcript:ENSTTRT00000001575 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLEDTCHRQDFNPNEYDLKFQRNVLDLSLQWRFANLPNNAKLEMVPISRSREGPENMVRI
ALQLDDGSRLQDTFCSGQTLWELLCRFAQIRECLDRPCEASPVCVYMRDEVTGRAALQST
TLQSLGLTGGSAIIRFSMKRHDSTGRSPGSPTPSLSADQAASSPPFPLNSAELSQGDVSH
QDEAASPGAGREPVDAQAKQISKEPTPAPFVPFSGGGQLLGGPSGSVRPLMSSSAKLPKS
SSPAGPSQPKKSRPGQEPQPEPELVRPPVDRDPVVCHPDLEVLLQAWPAELPDEFFEVTV
DDVRRRLAQLKSERXXXXXXXXXXXXXXXXXXXXXXXXXXXVVLRVLFPDRYILQGFFRP
SETVGDLRDFVRSHLGNPKLPFYLFIAPPKTILDDHTLTLFQANLFPAALVHFGPEEPTG
IYLEPTLLEHTISPSAADVLVARSMSRAAGTPPPPPAPDPAPVELEPTAEEGAVGPPEPS
PGTAQPVRRGLGKVPKWLKLPASKR
Download sequence
Identical sequences ENSTTRP00000001483 ENSTTRP00000001483

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]