SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000001573 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000001573
Domain Number 1 Region: 521-705
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 2.75e-44
Family cAMP-binding domain 0.00035
Further Details:      
 
Domain Number 2 Region: 251-426,456-517
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 9.42e-44
Family Voltage-gated potassium channels 0.0025
Further Details:      
 
Domain Number 3 Region: 38-131
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 2.27e-19
Family Flavin-binding PAS domain 0.0000187
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000001573   Gene: ENSTTRG00000001668   Transcript: ENSTTRT00000001668
Sequence length 996
Comment pep:novel genescaffold:turTru1:GeneScaffold_2666:298371:319066:1 gene:ENSTTRG00000001668 transcript:ENSTTRT00000001668 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVRRGHVSPHNTYLDTFIRKFEGQSRKFLIANAQMENCAIIYCNDGFCELFGYSRVEVM
QRPCTCDFLTGPNTPRSAMSRLAQALLGAEECKVDILYYRKDASSFRCLVDVVPVKNEDG
AVIMFILNFEDLAQLLAKRGSRSLSQRLLSQSFLGSEGSHGRPGAQGPGQGRVKYRTISQ
IPQFTLNFVEFNLEKHRSGSTTEIEIIAPHKVVERTQNVTEKVTQVLSLGADVLPEYQLQ
APRIHRGTLLHYSPFKAVWDWLILLLVIYTAIFTPYSAAFLLGDQDKPQRADCGYTCSPL
TTVDLIVDIMFVVDIVINFRTTYVNANDEVVSHPRRIAVHYFKGWFLIDMVAAIPFDLLI
FRTGSDETTTLIGLLKTARLLRLVRVARKLDRYSEYGAAVLFLLMCTFALIAHWLACIWY
AIGNVERPYLEPKIGWLDSLGAQLGKRYNGSDPASGPSVQDKYVTALYFTFSSLTSVGFG
NVSPNTNSEKVFSICVMLIGSLMYASIFGNVSAIIQRLYSGTARYHTQMLRVKEFIRFHQ
IPNPLRQRLEEYFQHAWSYTNGIDMNAVLKGFPECLQADICLHLHRALLQHCPAFHGASK
GCLRALAIKFKTTHAPPGDTLVHLGDVLSTLYFISRGSIEILRDDVVVAILGKNDIFGEP
VSLHARPGKSSADVRALTYCDLHKIQRADLLEVLDMYPAFADSFWSKLEVTFNLRDAGEG
LQSSPQQAPGSQDHQGFFLSDNQSATHPRLGPQAPSQGYSLLGPRSQTSMGVGPRTSGRP
GAAPSLSISDASGRWPELLQQVPPRPSQSPPNPQGDPDCWPRELGSRLEQLQAQMNRLES
RMSSDLSRILQLLQQPPPQDHTGYILGAPASNDLALSPSTSATQSPGTRLLPQGDLPPAQ
APSYGDLDEWRPKLGNSSSRMLAPATEMDKTTTPSSEQKQPEGLPSPLASPLHPLEVQGL
VCGPHFPSLPEHLSSVPKLEFRRHGSDPGFVRSSHC
Download sequence
Identical sequences ENSTTRP00000001573 ENSTTRP00000001573

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]