SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000001638 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000001638
Domain Number 1 Region: 268-324
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.94e-23
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 2 Region: 212-268
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.54e-21
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 
Domain Number 3 Region: 22-80
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 9.94e-21
Family KRAB domain (Kruppel-associated box) 0.0024
Further Details:      
 
Domain Number 4 Region: 309-361
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.61e-18
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 5 Region: 175-225
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.84e-16
Family Classic zinc finger, C2H2 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000001638   Gene: ENSTTRG00000001738   Transcript: ENSTTRT00000001735
Sequence length 408
Comment pep:novel genescaffold:turTru1:GeneScaffold_2971:80152:82319:-1 gene:ENSTTRG00000001738 transcript:ENSTTRT00000001735 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPPPAPLPAREPNGAGRQWGTPESLSFADVAVYFSPEEWGCLRPAQRALYRDVMRETYG
HLGALGFRGTKPALISWVEEEAELWGPDARDPETGECLREADTAGSRDKEEKGQREGTEA
LGKILSVDAQPPGLTALKPFSAGFSYGWEQPSKVPRRGRPPLCAHPPVPRADQRHGCYMC
GKSFAWRSTLVEHLYTHTGEKPFSCPDCGKGFSQASSLSKHRAIHRGERPHRCPDCDRAF
TQRSALTTHLRVHTGEKPYSCADCGRCFSQSSALYQHQRVHSGETPFPCPDCGRAFAHAS
DLRRHVRTHTGEKPYPCPDCGRCFRQSSEMAAHRRTHSGERPYACPQCGRCFGQKSAMAK
HQWVHRPGAGRRRGRGASGLPVPLASGRGDLDPPVGFQHYPEIFQECG
Download sequence
Identical sequences ENSTTRP00000001638 XP_019777296.1.83887 ENSTTRP00000001638

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]