SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000001642 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000001642
Domain Number 1 Region: 270-326
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.89e-22
Family Classic zinc finger, C2H2 0.008
Further Details:      
 
Domain Number 2 Region: 326-382
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.44e-21
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 
Domain Number 3 Region: 28-83
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.58e-21
Family KRAB domain (Kruppel-associated box) 0.0024
Further Details:      
 
Domain Number 4 Region: 186-242
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.78e-20
Family Classic zinc finger, C2H2 0.0087
Further Details:      
 
Domain Number 5 Region: 381-438
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.75e-19
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 6 Region: 423-475
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2e-18
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 7 Region: 150-199
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000228
Family Classic zinc finger, C2H2 0.0095
Further Details:      
 
Domain Number 8 Region: 232-264
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000354
Family Classic zinc finger, C2H2 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000001642   Gene: ENSTTRG00000001740   Transcript: ENSTTRT00000001739
Sequence length 500
Comment pep:novel genescaffold:turTru1:GeneScaffold_2971:114062:119142:-1 gene:ENSTTRG00000001740 transcript:ENSTTRT00000001739 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARPSAPLPARGPGEAGPGRRRGRRPRAVKFGDVAVYFSPEEWECLWPAQRALYRDVMQE
TYGHLGALGCAGPKPTLISWLERNTDDWEPAALDPQECPRRVTVQRKTRTRKKNEEKEVF
PPKEAPRKGKRGRRPSKPRLIPRQTSGGPICPDCGCTFPDHPALQSHKCAQNLKKPYPCP
DCGRRFSYPSLLVSHRRAHSGECPYVCDQCGKRFSQRKNLSQHQVIHTGEKPYHCPDCGR
CFRRSRSLANHRTTHTGEKPHQCPSCGRRFAYPSLLAIHQRTHTGEKPYTCLECSRRFRQ
RTALVIHQRIHTGEKPYPCPDCERRFSSSSRLVSHRRVHSGERPYACEHCEARFSQRSTL
LQHQLLHTGEKPYPCPDCGRAFRRSGSLAIHRSTHTEEKLHACDDCGRRFAYPSLLASHR
RVHSGERPYACDLCSKRFAQWSHLAQHQLLHTGEKPFPCLECGRCFRQRWSLAVHKCSPG
VQNCSPRSAIGVPSQKGNAL
Download sequence
Identical sequences ENSTTRP00000001642 ENSTTRP00000001642

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]