SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000001716 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000001716
Domain Number 1 Region: 146-283
Classification Level Classification E-value
Superfamily E set domains 7.46e-51
Family Cytoplasmic domain of inward rectifier potassium channel 0.00000751
Further Details:      
 
Domain Number 2 Region: 38-162
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 7.06e-24
Family Voltage-gated potassium channels 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000001716   Gene: ENSTTRG00000001824   Transcript: ENSTTRT00000001823
Sequence length 283
Comment pep:novel genescaffold:turTru1:GeneScaffold_2156:340212:341060:1 gene:ENSTTRG00000001824 transcript:ENSTTRT00000001823 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQENAAFSPGPEEQPRRRGRQRYVEKDGRCNVQQGNVRETYRYLTDLFTTLVDLQWRLS
LLFFVLAYALTWLFFGAIWWLIAYGRGDLEHLEDTAWTPCVNNLNGFVAAFLFSIETETT
IGYGHRVITDQCPEGIVLLLLQAILGSMVNAFMVGCMFVKISQPNKRAATLVFSSHAVVS
LRDGRLCLMFRVGDLRSSHIVEASIRAKLIRSRQTLEGEFIPLHQTDLSVGFDTGDDRLF
LVSPLVISHEIDAASPFWEASRRALERDDFEIVVILEGMVEAT
Download sequence
Identical sequences ENSTTRP00000001716 ENSTTRP00000001716

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]