SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000001868 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000001868
Domain Number 1 Region: 374-431
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.43e-22
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 2 Region: 262-319
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.75e-22
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 3 Region: 2-56
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.01e-21
Family KRAB domain (Kruppel-associated box) 0.0016
Further Details:      
 
Domain Number 4 Region: 318-375
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.59e-20
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 5 Region: 220-272
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.24e-19
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 6 Region: 418-477
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.02e-18
Family Classic zinc finger, C2H2 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000001868   Gene: ENSTTRG00000001993   Transcript: ENSTTRT00000001992
Sequence length 516
Comment pep:novel genescaffold:turTru1:GeneScaffold_1069:103099:105714:1 gene:ENSTTRG00000001993 transcript:ENSTTRT00000001992 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAFEDVAVYFSREEWGLLDAAQRALYRRVMLENFTLLASLGLSVSRPHVVIQLECGKEPW
VLNGTDVTLARNAQRRPSPASPHLAEDRDVSGXPTRVLSAGASECGKSLEGRCGVSPSRE
RKPTGVSVIYWESGETSVSLRLTSSLRAPPGEKALADHPAPGKQPRASERQKLYACEAPG
RAFPGAPEGDRGMGEAWREPQRLLAVSEPPTWAELGEALHAGEKPFECRACSKVFVKSSD
LLKHLRTHTGERPYECAQCGKAFSQTSHLTQHQRIHSGETPYTCPACGQAFRHSSSLVRH
QRIHTAEKAFRCAECGKAFSHRSNLSQHRKIHAGGRPYACTRCGRSFCRNSHLIQHERTH
TGEKPFACALCGAAFSQGSSLFKHRRVHTGEKPFACAQCGRAFSHSSNLRQHRLLHTGER
PFRCSDCGKAFAKGAVLLSHRRIHTGEKPFVCAQCGRAFRERPALFHHQRLHTGEKPARR
PRASPLPQARPPSGASCEGTLGREAGPTAASGPATV
Download sequence
Identical sequences ENSTTRP00000001868 ENSTTRP00000001868

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]