SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000001881 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000001881
Domain Number 1 Region: 85-431
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.71e-74
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.0000363
Further Details:      
 
Domain Number 2 Region: 484-554
Classification Level Classification E-value
Superfamily DUSP-like 0.0000000000955
Family DUSP, domain in ubiquitin-specific proteases 0.012
Further Details:      
 
Domain Number 3 Region: 948-1003
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000004
Family Ubiquitin-related 0.0085
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000001881
Domain Number - Region: 738-811
Classification Level Classification E-value
Superfamily DUSP-like 0.00288
Family DUSP, domain in ubiquitin-specific proteases 0.011
Further Details:      
 
Domain Number - Region: 648-688
Classification Level Classification E-value
Superfamily DUSP-like 0.0144
Family DUSP, domain in ubiquitin-specific proteases 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000001881   Gene: ENSTTRG00000002002   Transcript: ENSTTRT00000002005
Sequence length 1036
Comment pep:novel genescaffold:turTru1:GeneScaffold_294:87176:154341:-1 gene:ENSTTRG00000002002 transcript:ENSTTRT00000002005 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPRLQLEKAAWRWAETVRPEEVSQEHIETAYRIWLEPCIRGVCRRNCKGNPNCLVGIGE
HIWLGEIDENSFHNIDDPNCERRKKNSFVGLTNLGATCYVNTFLQVWFLNLELRQALYLC
PSTCSDYMMGDGIQEEKDYEPQTICEHLQYLFALLQNSNRRYIDPSGFVKALGLDTGQQQ
DAQEFSKLFMSLLEDTLSKQKNPDVRNIVQQQFCGEYAYVTVCNQCGRESKLLSKFYELE
LNIQGHKQLTDCISEFLKEEKLEGDNRYFCENCQSKQNATRKIRLLSLPXXXXXXXXXXX
XXXQTGHKKKLNTYIGFSEILDMEPYVEHKGGSYVYELSAVLIHRGVSAYSGHYIAHVKD
PQSGEWYKFNDEDIEKMEGKKLQLGIEEDLAEPSKSQTRKPKCGKGTHCSRNAYMLVYRL
QAQEKPNTTIQVPAFLQELVDRDNSKFEEWCIEMAEMRKQSVDKGKAKHEEVKELYQRLP
AGAEPYEFVSLEWLQKWLDESTPTKPIDNHACLCSHDKLHPDKISIMKRISEYAADIFYS
RYGGGPRLTVKALCKECVVERCRVLRLKNQLNEDYKTVNNLLKATVKGNDGFWVGKSSLR
SWRQLALEQLDEQDGDADQSSGKMNGNTLNKDESKEERKEEEEELNFNEDILCPHGELCI
SENERRLVSKEAWSKLQQYFPKAPEFPSYKECCSQCKILEREGEENEALHKMIANEQKTS
LPNLFQDKNRPCLSNWPEDTDVLYIVSQFFVEEWRKFVRKPTRCSPVSSVGNSALLCPHG
GLMFTFASMTKEDSKLIALIWPSEWQMIQKLFVVDHVIKIMRTEGGDADLSETQYISEPK
LCPECREGLLCQQQRDLREYTQATIYVHKVVDNKNVMKDSAPELNVSSSETEEDKEEAKP
DGEKDPDFNQSNGGTKRQKISHQNYIAYQKQVIRRSMRHRKVRGEKALLVSANQTLKELK
IQIMHAFSVAPFDQNLSIDGKILSDDCATLGTLGVIPESVILLKADEPIADYAAMDDVMQ
VCMPEEGFKGTGLLGH
Download sequence
Identical sequences ENSTTRP00000001881 ENSTTRP00000001881

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]