SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000001979 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000001979
Domain Number 1 Region: 2-61
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.31e-26
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 2 Region: 318-375
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.56e-26
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 3 Region: 374-431
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.21e-26
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 4 Region: 262-319
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.57e-25
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 5 Region: 207-263
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.86e-23
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 6 Region: 416-468
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.41e-21
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 7 Region: 154-207
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.1e-18
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000001979   Gene: ENSTTRG00000002108   Transcript: ENSTTRT00000002108
Sequence length 475
Comment pep:novel scaffold:turTru1:scaffold_91438:9741:18476:1 gene:ENSTTRG00000002108 transcript:ENSTTRT00000002108 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQGSVMFSDVSVDFSQEEWEFLDPAQRDLYRDVMLENYSNLVSVGLYIPKPQVISLLEQ
GKEPWMIGRELTRGLCSDLESMCETKLLSLKKEVYEIESCQREMMGLTKHGLEYSSFRDV
LEYRNHFERQVGYQNGHFSQEIFTHEYMPTSIQQTFFTLHQIINSEEKPYECKKCGKIFS
QNSQFLQHQRIHIGEKSYECKECGKFFSCGSHVTRHLKIHTGEKPFECKECGKAFSCSSY
LSQHQRIHTGKKPYECKECGKAFSYCSNLIDHQRIHTGEKPYECKVCGKAFTKSSQLFQH
VRIHTGEKPYECKECGKAFTQSSKLVQHQRIHTGEKPYECKECGKAFSSGSALTNHQRIH
TGEKPYDCKECGKAFTQSSQLRQHQRIHAGEKPFECLECGKAFTQNSQLFQHQRIHTDEK
PYECNECGKAFNKCSNLTRHLRIHTGEKPYNCKECGKAFSSGSDLIRHQGIHTDE
Download sequence
Identical sequences XP_019796788.1.83887 ENSTTRP00000001979 ENSTTRP00000001979

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]