SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000002332 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000002332
Domain Number 1 Region: 441-725
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.12e-68
Family Protein kinases, catalytic subunit 0.000000000818
Further Details:      
 
Domain Number 2 Region: 149-221
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.7e-24
Family Ras-binding domain, RBD 0.00035
Further Details:      
 
Domain Number 3 Region: 221-274
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000000000194
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.00049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000002332   Gene: ENSTTRG00000002489   Transcript: ENSTTRT00000002490
Sequence length 757
Comment pep:novel genescaffold:turTru1:GeneScaffold_2133:11750:150728:-1 gene:ENSTTRG00000002489 transcript:ENSTTRT00000002490 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAALSGGGGAEQGQALFNGDMEPEAGAAASSAADPAIPEEXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXAYEEYTSKLDALQQREQQLLESLGNGTDFSVSSSASTDTVTSSSSS
SLSVLPSSLSVFQNPTDVSRSNPKSPQKPIVRVFLPNKQRTVVPARCGVTVRDSLKKALM
MRGLIPECCAVYRIQDGEKKPIGWDTDISWLTGEELHVEVLENVPLTTHNFVRKTFFTLA
FCDFCRKLLFQGFRCQTCGYKFHQRCSTEVPLMCVNYDQLDLLFVSKFFEHHPIPQEEAS
LAETTLTSGSSPSAPPSDSIGPPILTSPSPSKSIPIPQPFRPDEDHRNQFGQRDRSSSAP
NVHINTIEPVNIDDLIRDQGFRSDGGSTTGLSATPPASLPGSLTNVKALQKSPGPQRERK
SSSSSEDRNRMKTLGRRDSSDDEIPDGQITVGQRIGSGSFGTVYKAKHGDVAVKMLNXXX
XXXXXXXXXXXXXXXXXKTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYHHLHIIETKFE
MIKLIDIARQTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGLATVKSRWSGSHQ
FEQLSGSILWMAPEVIRMQDKNPYSFQSDVYAFGIVLYELMTGQLPYSNINNRDQIIFMV
GRGYLSPDLSKVRSNCPKAMKRLMAECLKKKRDERPLFPQILASIELLARSLPKIHRSAS
EPSLNRAGFQTEDFSLYACASPKTPIQAGGYGAFPVH
Download sequence
Identical sequences ENSTTRP00000002332 ENSTTRP00000002332

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]