SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000002423 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000002423
Domain Number 1 Region: 478-534
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3e-24
Family Classic zinc finger, C2H2 0.0074
Further Details:      
 
Domain Number 2 Region: 2-56
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.58e-24
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 
Domain Number 3 Region: 421-478
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.57e-22
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 4 Region: 310-366
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.6e-22
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 5 Region: 366-422
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.67e-21
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 6 Region: 254-310
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.03e-21
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 7 Region: 519-571
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.78e-17
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 8 Region: 218-267
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000151
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 9 Region: 579-629
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000096
Family Classic zinc finger, C2H2 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000002423   Gene: ENSTTRG00000002583   Transcript: ENSTTRT00000002583
Sequence length 657
Comment pep:novel scaffold:turTru1:scaffold_101311:136028:147325:-1 gene:ENSTTRG00000002583 transcript:ENSTTRT00000002583 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAFRDVAVDFTQEEWMLLSPAQRSLYREVMLENYSNLVSLGIPFSKPKLITQLEQGKETW
REERKCPPATGPAEPKPELHLGPFRPPDFSSQQLRMQHMLCSHPPWIFTCWCAEEPVRPG
APCPGDQQQEQQQRASDGNPWNDKAEGQEREGTQPLFGKTKKRTSGVFPRPPPQQQPVNS
GDGIQGMEGVASPAQTGNPEETDRLLKRIEVLGFGTVNCGECGLGFSKMTNLLSHQRIHS
GEKPYVCGVCEKGFSLKKSLARHQKAHSGEKPIVCRECGRGFNRKSTLIIHERTHSGEKP
YMCSECGRGFSQKSNLIIHQRTHSGEKPYVCQECGKGFSQKSAVVRHQRTHLEEKTIVCS
DCGLGFSDRSNLISHQRTHSGEKPYACKECGRCFRQRTTLVNHQRTHSKEKPYVCGVCGH
SFSQNSTLISHRRTHTGEKPYVCGVCGRGFSLKSHLNRHQNIHSGDKPIVCKDCGRGFSQ
QSNLIRHQRTHSGEKPMVCEECGRGFSQKSNLVAHQRTHSGEKPYVCRECGRGFSHQAGL
IRHRRKHSREKPYTCRQCGLGFSNKSALITHKWVHSEEKPCLFRECGQGFPQKSHLILHQ
MTHQGRKPYVCKTCGQGFSQKSHLSRHRRMKSAHHKLRLQSDPEAYSEQSSDPLHSL
Download sequence
Identical sequences ENSTTRP00000002423 ENSTTRP00000002423

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]