SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000002473 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000002473
Domain Number 1 Region: 508-560
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.05e-18
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 2 Region: 100-143
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.00000000000248
Family KRAB domain (Kruppel-associated box) 0.0052
Further Details:      
 
Domain Number 3 Region: 487-517
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000015
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 4 Region: 426-466
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000214
Family Classic zinc finger, C2H2 0.025
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000002473
Domain Number - Region: 9-81
Classification Level Classification E-value
Superfamily Tropomyosin 0.0183
Family Tropomyosin 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000002473   Gene: ENSTTRG00000002642   Transcript: ENSTTRT00000002637
Sequence length 620
Comment pep:novel genescaffold:turTru1:GeneScaffold_2999:11866:27458:-1 gene:ENSTTRG00000002642 transcript:ENSTTRT00000002637 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ISPWTMAATIQAMERKIESQAARLLSLEGRTGMAEKKLADCEKTAVELGNQLEGKWAVLG
TLLQEYGLLQRRLENVENLLRNRNFWILRLPPGSKGEAPKEWGNLSEWQKELYKHVMRGN
YETLVSLDYAISKPEVLSQIEQGKEPCSWRRAGPKVPDVPVDPSPGSGPPVPAPDLLMQI
KQEGELQLQEQQALGVEAWAAGQPDIGEEPWGLSQLDSGAGDVSTDAASGVHSNFSTTIP
PTSWQADLPPHHPSSACSDGTLKLSTAASTEDVKIVIKTEVQEEEVVATPVHPTDLEAHA
TLFGPGQATRFFPSPVQEGAWESQGSSFPSQDPVLGLREPARPERELGEPSPAVTQDETP
PGDWLFGGVRWGWNFRCKPPASLNPRTGPEGLAYSSPDNGEAVLDPGQAPRPFSDPCKYP
GRTKGFGHKPGLKKHPAAPPGGRPFTCAACGKSFQLQVSLSAHQRSCGGLPDGAGGGGGA
RDGSGLRCGECGRCFTRPAHLIRHRMLHTGERPFPCTECEKRFTERSKLIDHYRTHTGVR
PFTCTVCGKSFIRKDHLRKHQRNHAAGAKPARGQPLPPLPAVPPDPFKSPASKGPLASTD
LVTDWTCGLSVLGPTDGGDL
Download sequence
Identical sequences ENSTTRP00000002473 ENSTTRP00000002473

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]