SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000002630 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000002630
Domain Number 1 Region: 3-198
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.52e-50
Family Phosphate binding protein-like 0.0000178
Further Details:      
 
Domain Number 2 Region: 200-258,292-313
Classification Level Classification E-value
Superfamily Porphobilinogen deaminase (hydroxymethylbilane synthase), C-terminal domain 3.27e-18
Family Porphobilinogen deaminase (hydroxymethylbilane synthase), C-terminal domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000002630   Gene: ENSTTRG00000002806   Transcript: ENSTTRT00000002806
Sequence length 322
Comment pep:novel genescaffold:turTru1:GeneScaffold_2206:32990:37382:1 gene:ENSTTRG00000002806 transcript:ENSTTRT00000002806 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LRIQTDSVVATLKYTRLQFEIIAMSTTGDKILDTALSKIGEKSLFTKELEHALERNEVDL
VVHSLKDLPTVLPPGFTIGAICKRESPYDAVVFHPKFVGKTLETLPEKSLITISLAAQLQ
RKFPHLKFKSRGNLNTRLRKLDELQEFSAILLAAPGLQRMGWQNRILHPEECMYAVGQGA
LGVEVRAKDQDILDLVGVLHDPETLLRCIAERAFLRHLEGGCSVPVAVHTAMKDGQLYLT
GGVWSLNGADSMQETMQATIHVPAQHEDGPEDDPQLVGITARNIPRRAQLAAESLGISLA
TLLLNKGAKNILDVARQLNDAH
Download sequence
Identical sequences ENSTTRP00000002630 ENSTTRP00000002630

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]