SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000002740 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000002740
Domain Number 1 Region: 328-385
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.45e-24
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 2 Region: 272-329
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.62e-22
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 3 Region: 440-497
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.33e-21
Family Classic zinc finger, C2H2 0.0076
Further Details:      
 
Domain Number 4 Region: 486-538
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.48e-20
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 5 Region: 2-59
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.97e-20
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 
Domain Number 6 Region: 234-286
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.52e-19
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 7 Region: 384-441
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.84e-17
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000002740   Gene: ENSTTRG00000002923   Transcript: ENSTTRT00000002921
Sequence length 570
Comment pep:novel scaffold:turTru1:scaffold_115064:10654:14783:1 gene:ENSTTRG00000002923 transcript:ENSTTRT00000002921 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LQVTFSDVAIDFSHEEWGWLDPTQRNLYKDVMVQNYENLVSLAGLSIPKPYVIALLEDGK
EPWMVEKKLSKSLFPDWKSRWESKELSTKEDIYDEDFPQMVIMEKTIKQSHEFSNFNKDL
DYIEKLEGKCENQVEHFRPVTLTFRESPTGESVYKCSKFRSILPLKSILSEPQRISAEGK
SHKRDIFKKSLPANSVIKNENISDGKKLLNSDESVAAFSQSKSLTLHQTFNREKIYTCSE
CGKAFGKQSILNRHWRIHTGEKPYECHECGKTFSHGSSLTRHQISHSGEKPYKCIECGKA
FSHVSSLTNHQSTHTGEKPYECMNCGKAFSRVSHLIEHLRIHTQEKLYECRICGKAFIHR
SSLIHHQKIHTGEKPYECSECGKAFCCSSHLTRHQRIHSIEKQFECNKCLKVFSSLSFLI
QHQSIHTEEKPFECQKCRKSFSQPESLNMHLRNHTRLKPYECSICGKAFSHRASLFQHHR
IHTGEKPYECIKCGKTFSCSSNLTVHQRIHTGEKPYKCNECGKAFSKGSNLTAHQRVHNG
EKPSSTISVEKPLGHINHYTCERSYKRETA
Download sequence
Identical sequences ENSTTRP00000002740 ENSTTRP00000002740

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]