SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000002745 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000002745
Domain Number 1 Region: 402-459
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.15e-25
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 2 Region: 486-543
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.29e-24
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 3 Region: 237-291
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.01e-23
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 4 Region: 346-403
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1e-22
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 5 Region: 7-64
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.29e-21
Family KRAB domain (Kruppel-associated box) 0.0015
Further Details:      
 
Domain Number 6 Region: 290-347
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.29e-21
Family Classic zinc finger, C2H2 0.0074
Further Details:      
 
Domain Number 7 Region: 528-580
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.49e-18
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 8 Region: 197-248
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.22e-16
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 9 Region: 449-481
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000406
Family Classic zinc finger, C2H2 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000002745   Gene: ENSTTRG00000002936   Transcript: ENSTTRT00000002928
Sequence length 587
Comment pep:novel scaffold:turTru1:scaffold_115064:29076:42456:-1 gene:ENSTTRG00000002936 transcript:ENSTTRT00000002928 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPELALVSFEDVAVTFTGEEWRHLDLAQRTLYQEVMLETCGLLVSLGHPVPKPELIHL
LEHGQELRTVKRGLSRSTCTXXXXXXXXXXXTASHLVLTERAPFEERVTHGASRHRLEQA
RDQEKLSEMQEGNLRPGTDIHKETCPRKLSHKHDDFETDDSLYLRVLQERVTTRDALHER
DSQEPGGDPVTDARNNLYRCKECGKGFSKNWALVRHQQIHAGVKPYECSECGKACRYMAD
FIRHMRFHTGEKPYKCIECGKAFKRRSHLTEHQRIHTGDKPYECKECGKAFTHRSSFIQH
NMTHTREKPFLCKECGKAFYYSSSFAQHMRIHTGKKLYKCSECGKAFTHRSTFIQHNMTH
TGEKPFLCKECGKAFCLNSSFTQHMRIHTGEKPYECSECGRAFTHRSTFIRHKRTHTGEK
PFECKECGKAFCDSSSLIQHMRIHTGERPYECSECGKAFTHHSVFIRHNRTHSGEKPLEC
KECAKAFYYSSSFTRHMRIHTGEKPYVCRECGKAFTQPANFVRHNRIHTGEKPYECKECE
KAFCDNFALTQHMRTHTGEKPFECGECGKAFSHSSSFIHHRKIHTRV
Download sequence
Identical sequences ENSTTRP00000002745 ENSTTRP00000002745

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]