SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000002855 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000002855
Domain Number 1 Region: 695-1038
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.44e-91
Family Phoshoinositide 3-kinase (PI3K), catalytic domain 0.000000113
Further Details:      
 
Domain Number 2 Region: 523-675
Classification Level Classification E-value
Superfamily ARM repeat 2.59e-49
Family Phoshoinositide 3-kinase (PI3K) helical domain 0.00011
Further Details:      
 
Domain Number 3 Region: 292-441
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 7.63e-48
Family PLC-like (P variant) 0.0017
Further Details:      
 
Domain Number 4 Region: 106-260
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.34e-39
Family Ras-binding domain, RBD 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000002855   Gene: ENSTTRG00000003041   Transcript: ENSTTRT00000003041
Sequence length 1049
Comment pep:novel genescaffold:turTru1:GeneScaffold_2697:45541:57952:1 gene:ENSTTRG00000003041 transcript:ENSTTRT00000003041 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPGVDCPMEFWTKEENQSVAVDFLLPTGVYLNFSVSRNANLSTIKKVLWHRAQYEPLFH
MLSDPEAYVFTCVNQTAEQQELEDEQRRLCDIQPFLPVLRLVAREGDRVKKLINSQISLL
IGKGLHEFDSLQDPEVNDFRAKMRQFCEEVAAHRQQLGWEAWLQYSFPLQLEPSARSWGP
GTLRVPNRALLVNVKFEGSEESFTFQVSTKDVPLALMACALRKKATVFRQPLVEQPEDYT
LQVNGKHEYLYGSHPLCQFQVQKPRAKPPPIPLKKPASVSLWSLEQPFCIELIQGSKVNA
DERMKLVVQAGLFHGNETLCKTVSSSEVSVCSEPVWKQRLEFDINICDLPRMARLCFALY
AVIEKAKKARSTKKKSKKADCPIAWANLMLFDYKNQLKTGERCLYMWPSVPDEKGELLNP
CGTVRSNPNTESAAALVIFLPEVAPHPVYYPALDKLVGEMRLASHGRRSGMLTPCHAGES
PPLRVTGVLTPAPGAPQARLAQAPGAADSSRLQILELGRHGEHGRFTEEEQLQLREILER
RGSGELYEHEKDLVWKMRHEIQEHFPEALARLLLVTKWNKHEDVAQMLYLLCSWPELPVL
SALELLDFSFPDRHVGSFAIKSLRKLTDDELFQYLLQLVQVLKYESYLDCELTKFLLDRA
LANRKIGHFLFWHLLGFFRSRARLIIRVVQGEALSKLKALKDVVKVSSQKTTKPQTKELM
HLCMRQETYLEALSHLQSPLDPSTLLAEVCVEQCTFMDSKMKPLWVLYSNEEAGSDGTVG
IIFKNGDDLRQDMLTLQMIQLMDVLWKQEGLDLRMTPYGCLSTGDHTGLIEVVLHSDTIA
NIQLNKSNMAATAAFNKDALLNWLKSKNPGEALDRAIEEFTLSCAGYCVATYVLGIGDRH
SDNIMIRENGQLFHIDFGHFLGNFKTKFGINRERVPFILTYDFVHVIQQGKTNNSEKFER
FRGYCERAYTILRRHGLLFLHLFALMRAAGLPELSCSKDIQYLKDSLALGKTEEEALKHF
RVKFNEALRESWKTKVNWLAHNVSKDNRQ
Download sequence
Identical sequences ENSTTRP00000002855 ENSTTRP00000002855

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]