SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000002893 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000002893
Domain Number 1 Region: 169-268
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.27e-33
Family Ras-binding domain, RBD 0.0024
Further Details:      
 
Domain Number 2 Region: 311-419
Classification Level Classification E-value
Superfamily PH domain-like 7.4e-16
Family Pleckstrin-homology domain (PH domain) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000002893   Gene: ENSTTRG00000003084   Transcript: ENSTTRT00000003084
Sequence length 659
Comment pep:novel genescaffold:turTru1:GeneScaffold_300:16398:76087:1 gene:ENSTTRG00000003084 transcript:ENSTTRT00000003084 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGESNEDIDQMFSNLLGEMDLLTQSLGVDTVPPPEPKPSRAEFNYSVGFKDLNESLNALE
DQDLDALMADLVADIREAEQRTIQAQKESSQSRPHSASLDIPSFSGAASLGYTANVAAPS
ISQYEDDLPPPPADPMLDLPLPPPAPEPLSQEEEEAQAKADKIKLALEKLKEAKVKKLVV
KVHMNDNSTKSLMVDERQLARDVLDNLFEKTHCDCNVDWCLYEIYPELQIERFFEDHENV
VEVLSDWTRDTENKVLFLEKEEKYAVFKNPQXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
ESFCGTSIIVPELEGALYLKEDGKKSWKRRYFLLRASGIYYVPKGKTKTSRDLACFIQFE
NVNIYYGIQCKIKYKAPTDYCFVLKHPQIQKESQYIKYLCCDDARMLNQWVTGIRIAKYG
KTLYDSYQRAMARAGLASRWTNLGTVNAAPPAPSSTGVKTGTTQANGQIPQAAHSMSTVL
GEAQRHVETTKDKKSGLGSHDPAPRAQTLPMSSLPPPPPVRRSSEVGCSSPGTPPKVKGT
AAGFPAPPHDLLPPPPPPPPLEDDELPPPPPDFSDAPPDFVPPPPPPSFAGDAGSSLPPP
PPPPALVPEAAKPTPVVAKRPPAPPKRQANPGPPGGGGGEQDFMSDLMKALQKKRSNMS
Download sequence
Identical sequences ENSTTRP00000002893 ENSTTRP00000002893

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]