SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000002929 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000002929
Domain Number 1 Region: 729-1090
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.14e-96
Family Phoshoinositide 3-kinase (PI3K), catalytic domain 0.000000000014
Further Details:      
 
Domain Number 2 Region: 527-726
Classification Level Classification E-value
Superfamily ARM repeat 1.55e-60
Family Phoshoinositide 3-kinase (PI3K) helical domain 0.00000000452
Further Details:      
 
Domain Number 3 Region: 352-525
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.21e-53
Family PLC-like (P variant) 0.0000000291
Further Details:      
 
Domain Number 4 Region: 144-322
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.77e-47
Family Ras-binding domain, RBD 0.0000000239
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000002929   Gene: ENSTTRG00000003126   Transcript: ENSTTRT00000003126
Sequence length 1103
Comment pep:novel genescaffold:turTru1:GeneScaffold_670:17653:47412:1 gene:ENSTTRG00000003126 transcript:ENSTTRT00000003126 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELENHEQHVVLREDNRRRRRRMKPRSAAASLSSMELIPIEFVLPTSQRNTKTPETALLH
VAGHGNVEQMKAQVWLRALETSVAADFYHRLSPDHFLLLYQKKGQWYEIYDKYQVVQTLD
CLRYWKVLHRSPGQIHVVQRLAPSEETLAFQRQLTALIGYDVTDVSNVHDDELEFTVHRL
VSPRMAEVAGRDTKLYSAMHPWVTSKPLPEYLLKKITNNYIFIVIHRSTTSQTIKVSADD
TPGTILQSFFTKMAKKKSLMDIPESQNEQDFVLRVCGRDEYLVGETPIRNFQWVRQCLKN
GEEIHLVLDTPPDPALDEVRKEEWPLVDDCTGVTGYHEQLTIHGKDHESVFTVSLWDCDR
KFRVKIRGIDIPVLPRNADLTVFVEANIQYGQQVLCQRRTSPKPFTEEVLWNVWLEFSIK
IKDLPKGALLNLQIYCGKAPALSGKASAETPSPESRGKAQLLYYVNLLLIDHRFLLRHGE
YVLHMWQLSGKAEDHGSINADKLTSATNPDKENSMSISILLDNYCHPIALPKHRPTPDPE
GDRVRAEMPNQLRKQLEAIIATDPLNPLTAEDKELLWHFRYESLKDPKAYPKLFSSVKWG
QQEIVAKTYQLLARREVWDQSALDVGLTMQLLDCNFSDENVRAIAVQKLESLEDDDVLHY
LLQLVQAVKFEPYHDSALARFLLNRELRNKRIGHFLFWFLRSEIAQSRHYQQRFAVILEA
YLRGCGTAMLHDFTQQVQVIDMLQKVTMDIKSLSAEKYDVSSQXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXIEKCKVMASKKKPLWLEFKCADPTALSNETIGIIFKHGDDLR
QDMLILQILRIMESIWETESLDLCLLPYGCISTGDKIGMIEIVKDATTIAKIQQSTVGNT
GAFKDEVLNHWLKEKCPIEEKFQAAVERFVYSCAGYCVATFVLGIGDRHNDNIMISETGN
LFHIDFGHILGNYKSFLGINKERVPFVLTPDFLFVMGTSGKKTSRHFQKFQDVCVKAYLA
LRHHTNLLIILFSMMLMTGMPQLTSKEDIEYIRDALTVGKSEEDAKKYFLDQIEVCRDKG
WTVQFNWFLHLVLGIKQGEKHSA
Download sequence
Identical sequences ENSTTRP00000002929 ENSTTRP00000002929

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]