SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000002957 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000002957
Domain Number 1 Region: 109-303
Classification Level Classification E-value
Superfamily E set domains 3.5e-58
Family Cytoplasmic domain of inward rectifier potassium channel 0.0000306
Further Details:      
 
Domain Number 2 Region: 6-123
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.45e-20
Family Voltage-gated potassium channels 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000002957   Gene: ENSTTRG00000003154   Transcript: ENSTTRT00000003154
Sequence length 370
Comment pep:novel scaffold:turTru1:scaffold_109716:69616:70728:1 gene:ENSTTRG00000003154 transcript:ENSTTRT00000003154 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IFGEWGSYVVDIFTTLVDTKWRHMFVIFSLSYILSWLIFGSIFWLIAFHHGDLLNDPDIT
PCVDNVHSFTGAFLFSLETQTTIGYGSRCVTEECSAAVLMVILQSILSSIINTFIIGAAL
AKMATARKRAQTIRFSYFALIGMRDGKLCLMWRIGEFRPNHVVEGTVRAQLLRYTEDSDG
RMTMAFKDLKLVNDQIILVTPVTIVHEIDHESPLYALDRKAVAKDNFEILVTFIYTGDST
GTSHQSRSSYVPREILWGHRFNDVLEVKRKYYKVNCLQFEGSVEVYAPFCSAKQLDWKDQ
QIHNMGKGPPAQGPGTSDTNVRRRSFSAVAIVSSCENPEETTTSGTDQCKEAPYQKALLT
LNRISVESQM
Download sequence
Identical sequences ENSTTRP00000002957 ENSTTRP00000002957

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]