SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000003236 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000003236
Domain Number 1 Region: 1-79
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000345
Family Ubiquitin-related 0.0062
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000003236
Domain Number - Region: 107-156
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.002
Family Ubiquitin-related 0.028
Further Details:      
 
Domain Number - Region: 167-218
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0111
Family Ankyrin repeat 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000003236   Gene: ENSTTRG00000003453   Transcript: ENSTTRT00000003450
Sequence length 231
Comment pep:novel genescaffold:turTru1:GeneScaffold_2616:387835:418412:-1 gene:ENSTTRG00000003453 transcript:ENSTTRT00000003450 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRIFIAFEGSFEPFDISADETVEAVKLMIKDYFHIPLSEDEQARRYLELMYAGAALKDSW
SLTDVGISFCSTLKCFVKEEEKPTLCLFSAVTQETMPIMESISLLGKKVSDLRTLIALRC
GFPVSVFCLRTPEGLEMYDCNTLRDYQTDLGTTLRLDVWDGWKEFLMGCLLGQKLEVQRY
LSNEGTVLKYQKRVALYIAAFYRHTELTEWALKQGVRPHEMVGVHPYRAWC
Download sequence
Identical sequences ENSTTRP00000003236 ENSTTRP00000003236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]