SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000003261 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000003261
Domain Number 1 Region: 318-375
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.46e-23
Family Classic zinc finger, C2H2 0.0089
Further Details:      
 
Domain Number 2 Region: 206-263
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.78e-23
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 
Domain Number 3 Region: 374-431
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.72e-23
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 4 Region: 485-542
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.46e-21
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 5 Region: 262-319
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.94e-21
Family Classic zinc finger, C2H2 0.0074
Further Details:      
 
Domain Number 6 Region: 531-583
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.48e-21
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 7 Region: 3-47
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 6.54e-19
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 
Domain Number 8 Region: 416-468
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.24e-19
Family Classic zinc finger, C2H2 0.0087
Further Details:      
 
Domain Number 9 Region: 150-207
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.53e-18
Family Classic zinc finger, C2H2 0.0089
Further Details:      
 
Domain Number 10 Region: 111-160
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000149
Family Classic zinc finger, C2H2 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000003261   Gene: ENSTTRG00000003477   Transcript: ENSTTRT00000003478
Sequence length 624
Comment pep:novel scaffold:turTru1:scaffold_87552:36103:49621:-1 gene:ENSTTRG00000003477 transcript:ENSTTRT00000003478 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNSVVFEDVAVDFNLEEWALLDSAQRELYRDVMLENFRNLASVEDETQFKANGSVSQQDI
YGNKISKEHKISKFTGNDSLASVLGKIWEELSLEDQHIDQGRHLSRNHVVERLHSNDQCG
DGFSQTPNLNLYQKTLTGVKRYECSTRGKVFTHHSSLKSHIAVCTGHKPYQCQECGQAYS
CRSHLRTHVRTHSGERPYVCKLCGKTFPRTSSLNRHIRIHTAEKSYECQQCGKAFIDFSS
LTSHVRTHTGEKPYKCEECGKAFSYSSTFRRHMITHTGEKPYKCMECGEAFSYSSTFRRH
MISHTGETPHKCKECGEAFSYSSAFRRHMITHTGEKPYECKQCGKTFIYLQSFRSHERIH
TGEKPYECKQCGKAFIYPQSFRRHERTHGGEKPYECNQCGKAFSHPSSFRGHMRVHTGEK
PYECRQCGKTFNWPISLRKHTRTHTKEKPYECKQCGKAFSLSAFYQEHVRMHPGDKYECK
LCGKAFSCHISLQRHMRRHTAEKLYECKQCGKAFSWPELLQQHVRTHTAEKPYKCKECGK
VFKWPSSLPIHMRMHTGEKPYECKQCGKAFSCSSSLRRHVRIHTTKKHYINSGNPPANEF
MHSASENSHQERNLTKVVNLVLPL
Download sequence
Identical sequences ENSTTRP00000003261 ENSTTRP00000003261

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]