SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000003269 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000003269
Domain Number 1 Region: 885-1157
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.03e-77
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000283
Further Details:      
 
Domain Number 2 Region: 213-356
Classification Level Classification E-value
Superfamily PH domain-like 4.61e-31
Family Third domain of FERM 0.0067
Further Details:      
 
Domain Number 3 Region: 105-212
Classification Level Classification E-value
Superfamily Second domain of FERM 4.06e-29
Family Second domain of FERM 0.00041
Further Details:      
 
Domain Number 4 Region: 18-104
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.17e-20
Family First domain of FERM 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000003269   Gene: ENSTTRG00000003487   Transcript: ENSTTRT00000003486
Sequence length 1157
Comment pep:novel genescaffold:turTru1:GeneScaffold_1696:152984:251961:-1 gene:ENSTTRG00000003487 transcript:ENSTTRT00000003486 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPFGLKLRRTRRYNVLSKNCFVTRIRLLDSNVIECTLSVESTGQECLEAVAQRLELRETH
YFGLWFLSKSQQARWVELEKPLKKHLDKFANEPLLFFGVMFYVPNVSWLQQEATRYQYYL
QVKKDVLEGRLRCTLEQVIRLAGLAVQADFGDYNQFDSQDFLREYVLFPMDLALEEAVLE
ELTQKVAQEHKAHSGILPAEAELMYINEVERLDGFGQEIFPVKDNHGNSVHLGIFFMGIF
VRNRIGRQAVIYRWNDMGNITHNKSTILVELISKEETALFHTDDIENAKYISRLFATRHK
FYKQNKICTEQSNSPPPIRRQPTWSRSSLPRQQPYILPPMHVQCGEHYSETHTSQDSIFH
GNEEALYCNSHNSLDLSYINGTVTNGSVCSIHSVNSLSCSQSFIQASPVSSNLSIPGSDI
MRADYIPSHRHSAIIVPSYRPTPDYETVMRQMKRGVVHTDSQSQSLRNLNIINTHAYNQP
EDLVYSQPEMRERHPYTVPYGPQGGYGNKLVSPSDQINPKNTTVPSKPGASAISHTVSTP
ELANMQLQGTYNYNTAHMLKNYLFRPPPPYPRPRPATSTPDLASHRHKYVSGSSPDLVTR
KVQLSVKTFQEDSSPVVHQSLQEVSEPLTATKHHGTVHKRHSLEVMSSMVRGMEAMTLKS
LNIPMARRNTLREPGPPEEVPGSHEVPQLPEYHHRKTFSDATMLIHSSESEEEEEEAPDP
VPQIPVLREKMEYSAQLQAALARIPNKPPPEYPGPRKSVSNGALGQDQVCLPPAIARARV
LRQGPAKAISISRADQMAINGSSLGPSISEPDLTSVKERVKKEPVKERPVSEMFSLEDSI
IEREMMIRNLEKQKMAGLEAQKRPLMLAALNGLSVARGSGREESRVDATRVPMDERFRTL
KKKLEEGMVFTEYEQIPKKKANGVFSTAALPENAERSRIREVVPYEENRVELIPTKENNT
GYINASHIKVVVGGAEWHYIATQGPLPHTCHDFWQMVWEQGANVIAMVTAEEEGGRTKSH
RYWPKLGSKHSSATYGKFKVTTKFRTDSGCYATTGLKVKHLLSGQERTVWHLQYTDWPDH
GCPEDVQGFLSYLEEIQSVRRHTNSMLESTKNQHPPIVVHCSAGVGRTGVVILSELMIYC
LEHNEKVEVPMMLRLLR
Download sequence
Identical sequences ENSTTRP00000003269 ENSTTRP00000003269

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]