SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000003376 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000003376
Domain Number 1 Region: 3-85
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.17e-21
Family Ubiquitin-related 0.0000189
Further Details:      
 
Domain Number 2 Region: 228-293
Classification Level Classification E-value
Superfamily XPC-binding domain 1.31e-21
Family XPC-binding domain 0.0000365
Further Details:      
 
Domain Number 3 Region: 303-361
Classification Level Classification E-value
Superfamily UBA-like 0.000000000000134
Family UBA domain 0.00035
Further Details:      
 
Domain Number 4 Region: 152-203
Classification Level Classification E-value
Superfamily UBA-like 0.000000000000222
Family UBA domain 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000003376   Gene: ENSTTRG00000003601   Transcript: ENSTTRT00000003601
Sequence length 363
Comment pep:novel genescaffold:turTru1:GeneScaffold_112:135805:140975:1 gene:ENSTTRG00000003601 transcript:ENSTTRT00000003601 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVTITLKTLQQQTFKIRMEPDETVKVLKEKIEAEKGRDAFPVAGQKLIYAGKILSDDVP
IKDYHIDEKNFVVVMVTKAKTSPGTSVPPEASPTAAPESXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXSVPSSGSSGREEDAASTLVTGSEYETMLTEIMSMGYERERV
VAALRASYNNPHRAVEYLLTGIPGSPEPEHGSVQESQVPEQPATEAAGENPLEFLRDQPQ
FQNMRQVIQQNPALLPALLQQLGQENPQLLQQISRHQEQFIQMLNEPPGELADISDVEGE
VGAIGEEAPQMNYIQVTPQEKEAIERLKALGFPESLVIQAYFACEKNENLAANFLLSQNF
DDE
Download sequence
Identical sequences ENSTTRP00000003376 ENSTTRP00000003376

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]