SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000003431 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000003431
Domain Number 1 Region: 1-44
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.96e-20
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 
Domain Number 2 Region: 130-172
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000193
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 3 Region: 52-100
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000006
Family Classic zinc finger, C2H2 0.041
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000003431
Domain Number - Region: 193-245
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00617
Family Classic zinc finger, C2H2 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000003431   Gene: ENSTTRG00000003655   Transcript: ENSTTRT00000003657
Sequence length 343
Comment pep:novel genescaffold:turTru1:GeneScaffold_1057:39080:45502:-1 gene:ENSTTRG00000003655 transcript:ENSTTRT00000003657 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FQVPLTFSDVAIDFSQEEWECLNSDQRNLYRDVMLENYTNLISLCGKAFVRVNLIKHGKI
FPGKDHKKHKKAFKLSSNLNAHKRIHDDIKPCEYRKCEKKYRMHKTYPTQIHSGVKIKHE
ECRKALHASRPVHRWIHIGGRPYKFKKCGKAFISDCQVPEYENIHTDLKYFERWKIFAFT
STLIIQKRIKIVKFQKCKECGKVLRVHGSLHQKVTGGKPYEKERKAFHHVSHLVQHEIHI
SDKTYRKKCGLAIRDGSALKAHRVIHIGLNLEYKEYRNSFRHSQSLHQIIPTTGKSDYEL
YAFSKYSNSLSYQRIDNSTQHKRASNCTHVLIEYQTINRVNSQ
Download sequence
Identical sequences ENSTTRP00000003431 ENSTTRP00000003431

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]