SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000003438 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000003438
Domain Number 1 Region: 520-577
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.16e-26
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 2 Region: 465-521
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.77e-24
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 3 Region: 577-633
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.05e-24
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 4 Region: 297-353
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.12e-23
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 5 Region: 241-297
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.28e-23
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 6 Region: 353-409
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.13e-22
Family Classic zinc finger, C2H2 0.0085
Further Details:      
 
Domain Number 7 Region: 618-670
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.21e-22
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 8 Region: 184-241
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.71e-22
Family Classic zinc finger, C2H2 0.0085
Further Details:      
 
Domain Number 9 Region: 409-465
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.62e-20
Family Classic zinc finger, C2H2 0.0085
Further Details:      
 
Domain Number 10 Region: 4-59
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.79e-20
Family KRAB domain (Kruppel-associated box) 0.00085
Further Details:      
 
Domain Number 11 Region: 146-198
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000171
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000003438   Gene: ENSTTRG00000003667   Transcript: ENSTTRT00000003665
Sequence length 700
Comment pep:novel genescaffold:turTru1:GeneScaffold_1057:105229:112290:1 gene:ENSTTRG00000003667 transcript:ENSTTRT00000003665 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSTFSEAVTFKDVAVTFTEEELGLLDSTQRKLYQEVMLENFRNLVSVGCHPFKHDIFHLE
KEKRLWVVKAATQREGTSEGKIQSEMETVSEAGPHEELSSWQIWQHIASDFTRCQDSMIK
SSEFHQHGDSSGQVGAGFSETHTGQKPYQCNECTRSFSDVSNFDLHQQIHPGEKSHTCVE
CGKSFCYSSALRIHQRVHSGEKRYKCDECGKEFSQSSQLQAHQKVHTVEKPFRCEQCGKG
FSRRSTLTVHCKLHMGEKPYNCDQCGRAFIHASHLQEHQRIHTGEKPFKCDICGKNFRRR
SALNSHCMVHTGEKPYKCDECGKCFTCSSNLHIHQRVHTGEKPYKCEECGKCFIQPSQFQ
AHRRIHTGEKPYVCKVCGKGFIYSSSFQAHQGVHTGEKPYRCSECGKHFRMKIHYQVHLV
IHTGEKPYKCEVCGKGFRQSSYLKIHQKAHSIEKPYKCEECGQGFNQSSRLQIHQLIHTG
EKPYKCEECGKGFSRRADLKIHCRIHTGEKPYNCEECGKVFSQASHLLTHQRVHSGEKPF
KCEECGKSFSRSSHLQAHQKVHTGEKPYKCEECGKGFKWSLNLDMHQRVHTGEKPYKCGE
CGKHFSQASSLQLHQSVHTGEKPYRCDVCGKVFSRSSQLQYHRRVHTGEKPYQCETCGKS
FSWRSNLVSHHKMHTGDTFYESSESGKNIKELSEERSSTK
Download sequence
Identical sequences ENSTTRP00000003438 ENSTTRP00000003438

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]