SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000003443 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000003443
Domain Number 1 Region: 506-562
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.93e-25
Family Classic zinc finger, C2H2 0.007
Further Details:      
 
Domain Number 2 Region: 618-674
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.51e-24
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 3 Region: 562-618
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.9e-24
Family Classic zinc finger, C2H2 0.0067
Further Details:      
 
Domain Number 4 Region: 338-394
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.29e-23
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 5 Region: 450-506
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.68e-22
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 6 Region: 17-78
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.35e-22
Family KRAB domain (Kruppel-associated box) 0.00098
Further Details:      
 
Domain Number 7 Region: 394-450
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.79e-22
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 8 Region: 673-730
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.58e-21
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 9 Region: 715-767
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.71e-19
Family Classic zinc finger, C2H2 0.0063
Further Details:      
 
Domain Number 10 Region: 295-347
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.09e-19
Family Classic zinc finger, C2H2 0.0069
Further Details:      
 
Domain Number 11 Region: 228-259
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000545
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000003443
Domain Number - Region: 259-310
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000155
Family Classic zinc finger, C2H2 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000003443   Gene: ENSTTRG00000003672   Transcript: ENSTTRT00000003670
Sequence length 776
Comment pep:novel genescaffold:turTru1:GeneScaffold_1057:153897:162426:1 gene:ENSTTRG00000003672 transcript:ENSTTRT00000003670 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSQESDLPRKEWEKMTEFQEAVTFKDVAVTFTEEELGLLDSAQRKLYQDVMVENFRNLV
SVGHLPFKPDMVSQLETEEKIWMMERETQRSSKNPDEVETLGKVALKYLSCEEPSCWQIW
KQVASDSTCCLQRRTSHFLQGDSLQVSENENHMMNHKGDSSSYLENQEFLISRTQDSCGN
MYVSESGNQSRGKQMNGKNNPCICEAFMKKSPLSDPVTTDTEQKPCKGDTLYPCRECGRS
FSDSEVLPIHPRVHLGEKCSHLQSHQRIHPRGKVDKCESGDGFNRNSFHPRQSNHTGEKS
YRCDSCGKGFSSSTGLIIHYRTHTGEKPYKCEECGKCFSQSSNFQCHQRVHTEEKPYKCD
ECGKGFGWSVNLRVHQRVHRGEKPYKCEECGKGFTQAAHYHIHQRVHTGEKPYKCDVCGK
GFSHNSPLICHRRVHTGEKPYRCEACGKGFTRNTDLHIHFRVHTGEKPYKCKECGKGFSQ
ASNLQVHQNVHTGEKRFKCETCGKGFSQSSKLQTHQRVHTGEKPYRCDMCGKDFSYSSNL
KLHQVIHTGEKPYKCEECGKGFSWRSNLHAHQRVHSGEKPYKCEACDKSFSQAIDFRVHQ
RVHTGEKPYKCGVCGKGFSQSSGLQSHQRVHTGEKPYRCNMCGKGFRYSSQFIYHQRGHT
GEKPYKCEECGKAFGRSLNLRHHQRVHTGEKPHKCEECGKAFSLPSNLRVHLSVHAREKL
FKCEECGKGFSQSSRLHAHQRVHTGEKPYKCDICGKDFSHRSRLTYHQKVHTGKSL
Download sequence
Identical sequences ENSTTRP00000003443 ENSTTRP00000003443

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]