SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000003503 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000003503
Domain Number 1 Region: 202-343
Classification Level Classification E-value
Superfamily PH domain-like 1.11e-35
Family Third domain of FERM 0.0034
Further Details:      
 
Domain Number 2 Region: 99-204
Classification Level Classification E-value
Superfamily Second domain of FERM 1.44e-32
Family Second domain of FERM 0.0000885
Further Details:      
 
Domain Number 3 Region: 15-97
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.1e-26
Family First domain of FERM 0.00045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000003503   Gene: ENSTTRG00000003730   Transcript: ENSTTRT00000003730
Sequence length 568
Comment pep:novel genescaffold:turTru1:GeneScaffold_3618:145319:459606:-1 gene:ENSTTRG00000003730 transcript:ENSTTRT00000003730 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSRLMSGSSRSLEREYSCTVRLLDDSEYCTIQRDAKGQYLFDLLCHHLNLLEKDYFGIR
FVDPDKQRHWLEFTKSVGKQLRLRPPFTMCFRVKFYPADPAALKEEITRYLVFLQIKRDL
YHGRLLCKTSDAALLAAYILQAEIGDYDPGKHPEGYSSKFQFFPKHSEKLERKIAEIHKT
ELSGQTPATSELNFLRKAQTLETYGVDPHPCKDVSGNAAFLAFTPFGFVVLQGNKRVHFI
KWNEVTKLKFEGKTFYLYVSQKEEKKIILTFAPTPEACKHLWKCGIENQAFYKLEKSSQV
RTVSSSNLFFKGSRFRYSGRVAKEVMESSAKIKREPPEIHRAGMVPSRSCPSITHGPRLS
SVPRTRRRAVHISIMEGLESLRDSAHSTPVRTSSHGDTFLPHVRSSRADSNERVAVIADE
AYSPADSVLPTPVAEHSLELMLLSRQINGATCSIEEEKECETSTPTAAEMEALGGELRAL
CQGHGRPEEEQVNKFVLSVLRLLLVTMGLLFVLLLLLIILTESDLDIAFFRDIRQTPEFE
QFHYQYFCPLRRWFACKIRSVVSLLTDT
Download sequence
Identical sequences ENSTTRP00000003503 ENSTTRP00000003503

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]