SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000003505 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000003505
Domain Number 1 Region: 465-522
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.28e-25
Family Classic zinc finger, C2H2 0.007
Further Details:      
 
Domain Number 2 Region: 381-438
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.47e-25
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 3 Region: 5-64
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.53e-24
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 
Domain Number 4 Region: 511-563
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.21e-20
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 5 Region: 329-382
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000246
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 6 Region: 428-460
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000732
Family Classic zinc finger, C2H2 0.0065
Further Details:      
 
Domain Number 7 Region: 229-274
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000036
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 8 Region: 263-317
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000681
Family Classic zinc finger, C2H2 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000003505   Gene: ENSTTRG00000003732   Transcript: ENSTTRT00000003732
Sequence length 572
Comment pep:novel genescaffold:turTru1:GeneScaffold_3367:31259:41056:-1 gene:ENSTTRG00000003732 transcript:ENSTTRT00000003732 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VNSKEEQVSFKDVCVDFTQEEWYLLDPAQKILYRDVILENYSHLVSVGNCITKPEVIFKI
EQGEEPWILEERFPKQCCSEDWKVDDLIESSQENEDEHFWQLAFTNQTLSTDSGDRVRKT
LNLGTDSVPSRNFLYKVCDTCEMSLKNISGLIINRKNYSGKKPDEFNVYEKLLLDIRHEK
TPTGGKSYKYNQKKNRSPDLTQPIFDPHFEYNENGQGCHGEADSFTNKKAQIGETHCKYN
ECGRTFIQSLKLNLSQRTHLEMEPYECSICGKSFYMDLRLGHQRALTGENPYNEYGQIFC
DSSAFIIHQGNYTRKIPHEYKVSHKMWEKSTLFRHQIVHMGEKPYEHNENGNTFNKKSHL
TQLRRAHSGEKTFECGECGKTFWEKSNLTQHQRTHTGEKPYECTECGKAFCQKPHLTNHQ
RTHTGEKPYECKQCGKTFCVKSNLTEHQRTHTGEKPYECNACGKSFCHRSALTVHQRTHT
GEKPFICNECGKSFCVKSNLIVHQRTHTGEKPYKCNECGKTFCEKSALTKHQRTHTGEKP
YECNGCGKTFSQRSVLTKHQRIHTRVKALSAS
Download sequence
Identical sequences ENSTTRP00000003505 ENSTTRP00000003505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]