SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000003662 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000003662
Domain Number 1 Region: 288-345
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.75e-25
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 2 Region: 456-513
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.34e-24
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 3 Region: 1-56
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.1e-23
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 
Domain Number 4 Region: 400-457
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.98e-23
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 5 Region: 344-401
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.66e-23
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 6 Region: 241-289
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.86e-19
Family Classic zinc finger, C2H2 0.0084
Further Details:      
 
Domain Number 7 Region: 498-549
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000994
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000003662   Gene: ENSTTRG00000003895   Transcript: ENSTTRT00000003891
Sequence length 571
Comment pep:novel genescaffold:turTru1:GeneScaffold_22:108399:119489:1 gene:ENSTTRG00000003895 transcript:ENSTTRT00000003891 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALSQGLLTFKDVAITFSQEEWECLDPAQRALYRDVMLETYRNLLSLGEDISSPEVSAGF
AIKELSPREDITKGELYHLVILDRNDNHGIKDFDFKEVCADVQECESEWGCDARNDKEVL
LTHNKNLTHGDDHDNKSLINLPQSVSVRSNAREYFTHDKPFIRSSLTMKNNVSAARNRDL
KCLESRPGVRLQAQAAQLQRCAAEEKVYVCGQGEKPVSSGSSVSPLHRVLPSVENTLPPA
QHRRTHTREKSYSCNDCGKAFSKSSNLRNHRRIHSGQKPYRCNVCGKAFNQCSNLTTHQR
VHTGEKPYKCHVCGKVFSRNSHLANHQRMHTGEKPYKCHECGKAFIQHSLLWSHEKLHTG
EKPYNCNECGKAFAERSSLTQHETIHTGEKPYKCNECGRAFTQFSRLTRHQKMHAGEKPH
KCNVCGKAFIQRSSLMAHQRIHTGEKSYKCKDCDKAFIQRSQLWGHERTHTGEKPYKCNE
CGKAFTMRSYLTQHKTIHTGEKPYKCSQCGKAYTQFASLTRHQKIHTENKHKPNICGNAF
IQSSGFGDHQTIHSKKKPKGNDTLKYPSLTQ
Download sequence
Identical sequences ENSTTRP00000003662 ENSTTRP00000003662

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]