SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000003690 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000003690
Domain Number 1 Region: 95-232
Classification Level Classification E-value
Superfamily Cap-Gly domain 4.97e-29
Family Cap-Gly domain 0.0000253
Further Details:      
 
Domain Number 2 Region: 7-91
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.04e-25
Family Ubiquitin-related 0.00000924
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000003690   Gene: ENSTTRG00000003920   Transcript: ENSTTRT00000003920
Sequence length 243
Comment pep:novel genescaffold:turTru1:GeneScaffold_2219:296919:306377:1 gene:ENSTTRG00000003920 transcript:ENSTTRT00000003920 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVTGLSATVNIFISSSLNSFRSQKRYSRSLTIAEFKCKLQLVVGSPASCMELELYGPDD
KFYSKLDQEDALLGSYPVDDGCRIHVIDHSGARLGEYEDMSKVEKYEISQEAYDQRQXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPRRGTVMY
VGLTDFKPGYWIGVRYDEPLGKNDGSVNGKRYFECQAKYGAFVKPSVVTVGDFPEEDYGL
DEM
Download sequence
Identical sequences ENSTTRP00000003690 ENSTTRP00000003690

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]