SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000003772 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000003772
Domain Number 1 Region: 178-234
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.48e-25
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 2 Region: 234-290
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.16e-23
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 3 Region: 139-191
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.04e-19
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 4 Region: 8-55
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 7.59e-18
Family KRAB domain (Kruppel-associated box) 0.0016
Further Details:      
 
Domain Number 5 Region: 275-326
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000733
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000003772
Domain Number - Region: 317-352
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0216
Family Classic zinc finger, C2H2 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000003772   Gene: ENSTTRG00000004012   Transcript: ENSTTRT00000004005
Sequence length 353
Comment pep:novel genescaffold:turTru1:GeneScaffold_3262:1709:4624:1 gene:ENSTTRG00000004012 transcript:ENSTTRT00000004005 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAMLLMARRKVPVSFEDVSVYFTKTEWKLLDLRQRMLYKRVMLENYRHLVSLXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXDRMKSKPIISKQKTCSEELAGADLQGGNKGQ
VAGQQGLVLRQQGSKGAEKQFLCQQCGKSFSRSSNLIKHRIIHSGEKPYECGECGKLFRR
SFALLEHQRIHSGEKPYVCGECGKTFTRSSNLIKHQIIHSGEKPYECGECGKLFRRSFAL
LEHQRIHSGERPYTCSVCSKAFSRSSNLIEHQRTHSGEKPYTCSQCLKAFKGISQLIHHQ
RIHSGEKPFECKECKAFRGRSGLSQHRRVCSECGKFSQRSILFKHQVVHSEES
Download sequence
Identical sequences ENSTTRP00000003772 ENSTTRP00000003772

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]