SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000003810 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000003810
Domain Number 1 Region: 429-485
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.82e-23
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 2 Region: 372-429
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.12e-22
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 3 Region: 324-373
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.78e-19
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 4 Region: 470-522
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.56e-18
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 5 Region: 118-155
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.000000000000706
Family KRAB domain (Kruppel-associated box) 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000003810   Gene: ENSTTRG00000004054   Transcript: ENSTTRT00000004045
Sequence length 552
Comment pep:novel genescaffold:turTru1:GeneScaffold_43:46582:53335:1 gene:ENSTTRG00000004054 transcript:ENSTTRT00000004045 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSADGGGIRATQDKEGAPETPGHGHSCQEMLSESEGTVPLGAAQESPHIKMEPEEPHPEG
ASQEARAQGVRGWVPLSQGSKEKSHFLPGGALPSPQISVLSHEGRTRDRRMAAALLTAWS
QMPVTFEDVAVYLSREEWGRLDHTQQSFYRDILQKRNGLSLXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXHRRTHTGEKPYACTDCGKRFGRSSHLIQHQIIHTG
EKPYTCPSCWKSFSHHSTLIQHQRIHTGEKPYVCDRCAKRFTRRSDLVTHQGTHTGAKPH
KCPICGKCFTQSSALVTHQRTHTGVKPYPCPECGKCFSQRSNLIAHNRTHTGEKPYHCLD
CGKSFSHSSHLTAHQRTHRGVRPYSCPLCGKSFSRRSNLHRHEKIHTAGPKALAMLMLGA
AGALAAPPPAPT
Download sequence
Identical sequences ENSTTRP00000003810 ENSTTRP00000003810

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]