SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000003819 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000003819
Domain Number 1 Region: 38-128
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 1.19e-37
Family SCAN domain 0.0000617
Further Details:      
 
Domain Number 2 Region: 345-402
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.92e-23
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 3 Region: 307-359
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.76e-19
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 
Domain Number 4 Region: 387-439
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.09e-19
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 5 Region: 207-236
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.000000123
Family KRAB domain (Kruppel-associated box) 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000003819   Gene: ENSTTRG00000004055   Transcript: ENSTTRT00000004055
Sequence length 451
Comment pep:novel genescaffold:turTru1:GeneScaffold_43:59202:62928:1 gene:ENSTTRG00000004055 transcript:ENSTTRT00000004055 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPPEPQDQAPGEGEGLLIVKVEDSSWEQDAAQQEDSRDSEVCRQRFRQFCYGDAGGPH
EAFSQLWELCCRWLRPELRTKEQILELLVLEQFLSVLPVGVQGWVCERCPGSGEEAVALV
EDLQKQPVKAWPQDVPSEGAEPEAAVQGSQAQGPPRKAGTQSRPPVPWEQHSHGXXXXXX
XXXXXXXXXXXXXXXXXXXXXXTLDIFYSREEWGSLDPAQRDLFWDIKRENSQNIALGLG
LTSHSERSRLEEVVTALPGQAAGDVTVSWRLEEAEARPGVPRGRAAGARRGRPPTRRRQF
RDLAAEKPHSCGQCGKRFRWGSDLARHQRTHTGEKPHKCQECDKSFRSSSDLVRHQGVHT
GQKPFSCSECGKSFSRSAYLADHQRIHTGEKPFGCSDCGKSFSLRSYLLDHRRVHTGERP
FGCGECDKSFKQRAHLIAHQSLHAKMAQPVG
Download sequence
Identical sequences ENSTTRP00000003819 ENSTTRP00000003819

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]