SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000003830 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000003830
Domain Number 1 Region: 1-208,272-333
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 3.18e-32
Family D-aminoacid oxidase, N-terminal domain 0.0000000148
Further Details:      
 
Domain Number 2 Region: 195-287
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 2.09e-23
Family D-aminoacid oxidase-like 0.00000589
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000003830   Gene: ENSTTRG00000004069   Transcript: ENSTTRT00000004066
Sequence length 347
Comment pep:novel genescaffold:turTru1:GeneScaffold_3613:327611:341062:1 gene:ENSTTRG00000004069 transcript:ENSTTRT00000004066 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRVVVIGAGVIGLSTALCIHERYHSVLQSLDVKVYAERFTPLTNTDVAAGLWQPYLSEPS
NPQEARWNQQTFNYLLSHIGSPNAADMGLAPVSGYNLFREAVPDPYWKDVVLGFRKLTPR
ELDMFPDYSYGWFNTSLILEGRKYLQWLTERLTERGVKFLLRKVESFEEVARGDADVIIN
CTGVWAGALQPDPLLQPGRGQTIKVDAPWMKHFIITHDPERGIYKSPYIIPGIQAVTLGG
IFQLGNWSETNNIQDHNTIWEGCCRLEPTLKDAKIVSECTGFRPVRPQVRLEREQLHVGS
SNTEVIHNYGHGGYGLTIHWGCALEVAKIFGKILEERNLLRMPPSHL
Download sequence
Identical sequences ENSTTRP00000003830 XP_004281424.1.21590 ENSTTRP00000003830

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]