SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000003977 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000003977
Domain Number 1 Region: 450-507
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.9e-25
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 2 Region: 17-77
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.7e-24
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 
Domain Number 3 Region: 562-619
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.91e-24
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 4 Region: 338-395
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.16e-23
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 5 Region: 506-563
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.2e-22
Family Classic zinc finger, C2H2 0.0087
Further Details:      
 
Domain Number 6 Region: 395-451
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.94e-22
Family Classic zinc finger, C2H2 0.0082
Further Details:      
 
Domain Number 7 Region: 604-656
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.4e-20
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 8 Region: 283-339
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000038
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 9 Region: 226-283
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000399
Family Classic zinc finger, C2H2 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000003977   Gene: ENSTTRG00000004239   Transcript: ENSTTRT00000004226
Sequence length 661
Comment pep:novel scaffold:turTru1:scaffold_114315:68692:128809:1 gene:ENSTTRG00000004239 transcript:ENSTTRT00000004226 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPANRCAPGPGGCDNSCEVSVSFEDVTVDFSREEWQQLDSTQRRLYQDVMLENYSHLLSL
GCEIPKPEVIFKLEQGEEPWTLEEETPHQSCSDEKFGIKTSQKRISGKVSFHSEMEGEDT
RDDSLYSILEELWHGAEQIKSYQENQNKPLSHAAFINKKILNTEWDYGYKDSGKFVHPGP
NRIPSQKRSHKRDSFGKSLKYNLDVPIHNKNNATKNFDKIIGHGEVFTQSSSYTNHENTH
TGVKFCDSNPCGKVFSFKQALSHNLKFPVGEKANMCTELGKIFTQRSHLFAPQRIHTMEK
PHELSKCVNVFTQKPLLSIYLRVHRDEKLYICSECGKAFIQNSELIMHEKIHTREKPYKC
SECGKSFFQVSSLLRHQTTHTGEKLYECSECGKGFSLNSALNVHQKIHTGERHHKCSECG
KAFTQKSTLRMHQRIHTGERSYICTECGQAFIQKAHLIAHQRIHTGEKPYECSDCGKSFP
SKSQLQMHKRIHTGEKPYICTNCGKAFTNRSNLNTHQKSHTGEKSYICAECGKAFTDRSN
FNKHQTIHTGEKPYVCADCGRAFIQKSELITHQRIHTTEKPYKCSDCEKSFSKKPHLKVH
QRIHTGEKPYICAECGKAFTDRSNFNKHQTIHTGEKPYKCSDCGKGFTQKSVLSMHRNIH
T
Download sequence
Identical sequences ENSTTRP00000003977 ENSTTRP00000003977

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]