SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000004051 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000004051
Domain Number 1 Region: 651-739
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.81e-33
Family Ras-binding domain, RBD 0.00000973
Further Details:      
 
Domain Number 2 Region: 381-527
Classification Level Classification E-value
Superfamily Ras GEF 3.01e-28
Family Ras GEF 0.0015
Further Details:      
 
Domain Number 3 Region: 90-262
Classification Level Classification E-value
Superfamily Ras GEF 8.5e-21
Family Ras GEF 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000004051   Gene: ENSTTRG00000004307   Transcript: ENSTTRT00000004307
Sequence length 782
Comment pep:novel genescaffold:turTru1:GeneScaffold_3463:302646:310006:-1 gene:ENSTTRG00000004307 transcript:ENSTTRT00000004307 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPRPLRLFWDTSPPGGVVLSSFRSRDPEEGGGPGGWGVGGGQEEEEEEEEEEEDDEAPV
SVWDEEEDGATFTVTSRQYRSVDPLAPRPPPRSFRRLRAGTLEALVRHLLDTRTSGTDVT
FTAAFLATHRAFTSTPALLGLMADRLEALESHPTDELERTKGVAISVLSTWLASHPEDFG
SEVKGQIDRLESFLLRTGYAAGEGVGGGGADLIRNLRSRVDPQTPELPKPLALPGDPPAD
PTDVLVFLADHLAEQLTLLDAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXARDSLRVFSSLCQIFSEEDNYSQSRELLLQEVKLQPSLEPNS
KKSPRSGSRGGGVVPYLGTFLKDLVMLDAASKDELENGYINFDKRRKEFAVLSELRQLQN
KCRGYDLRPDPDIQRWLQGLRPLTEAQSHQVSCEVEPSSSSDPPAPRVLRPTLVISQWTE
VLGSVGGPTPLVSWDWPNVGAEEVPATPAPLLTRLAQHMKWPSVSSLDSALESTPALQSP
ADPSHLSPPASSPRPSRGHRRSASCGSPLSGGAEGASRGPGYGGGGPGPGASDCRIIRVQ
MELGEDGSVYKSILVTSQDKAPSVISRVLKKNNRDSAVASEYELVQLLPGERELTIPPSA
NVFYAMDGASLDFLLRQRRRPSTATLGRASGPSASGTPPSEGGGGSFPRIKAKGRKIARA
LF
Download sequence
Identical sequences ENSTTRP00000004051 ENSTTRP00000004051

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]