SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000004243 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000004243
Domain Number 1 Region: 8-69
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.32e-26
Family KRAB domain (Kruppel-associated box) 0.00081
Further Details:      
 
Domain Number 2 Region: 160-217
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.73e-26
Family Classic zinc finger, C2H2 0.0072
Further Details:      
 
Domain Number 3 Region: 216-273
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.54e-24
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 4 Region: 258-310
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.35e-21
Family Classic zinc finger, C2H2 0.008
Further Details:      
 
Domain Number 5 Region: 118-170
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.7e-19
Family Classic zinc finger, C2H2 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000004243   Gene: ENSTTRG00000004515   Transcript: ENSTTRT00000004505
Sequence length 321
Comment pep:novel scaffold:turTru1:scaffold_89437:11905:15411:-1 gene:ENSTTRG00000004515 transcript:ENSTTRT00000004505 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAGLLTTWSQDLVTFEEVAVDFSQEEWALLDPAQKILYRDVMLENFRNLASVGYHLCKH
SLFTEVEQEELRPEQRRILQGAYRDQDTQLKSKDAILTQNVPGEKTSNGIKTICVRPHAG
EKRYECSNCGKAFVFQSSLKKHVRSHTGEKPYECNHCGKSFSQSSHLNVHKRTHTGEKPY
DCKECGKAFTVPSSLQKHMRTHTGEKPYECSDCGKSFIDQSSLKKHTRSHTGEKPYECNQ
CGKSFSTGSYLIVHKRTHTGEKTYECKECGKAFRNSSCLRVHMRTHTGEKPYKCIQCGKA
FSTSTNLIMHKRIHTGQKLYE
Download sequence
Identical sequences ENSTTRP00000004243 ENSTTRP00000004243

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]