SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000004311 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000004311
Domain Number 1 Region: 217-274
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.2e-24
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 2 Region: 330-384
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.36e-24
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 3 Region: 274-330
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.81e-23
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 4 Region: 389-442
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.61e-23
Family Classic zinc finger, C2H2 0.0085
Further Details:      
 
Domain Number 5 Region: 133-190
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.67e-23
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 6 Region: 8-61
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.44e-21
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 7 Region: 77-134
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.09e-20
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 8 Region: 457-516
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.84e-19
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 9 Region: 180-212
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000571
Family Classic zinc finger, C2H2 0.0081
Further Details:      
 
Domain Number 10 Region: 507-538
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000708
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000004311   Gene: ENSTTRG00000004585   Transcript: ENSTTRT00000004576
Sequence length 539
Comment pep:novel scaffold:turTru1:scaffold_93007:23802:31395:-1 gene:ENSTTRG00000004585 transcript:ENSTTRT00000004576 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KTAQESLTDDVAMKFTWEEWQLLDPDQKDLCWDVMLENYSNLLSVGYQASKPDVVSRLER
GRWPVEDDCHSRICPEAFSRKSRLTEHQRTHTGLKHYECTECSKTFFKKSQFNKHQKSHI
GEKPYTCSECGKAFTTKCLLIYHQRTHTGEKPHGCSLCGKAFSTKFSLTTHQKTHTGEKP
YICSECGKGFIEKRRLIAHCRTHTGEKPFVCSECGKSFTLKKSLIPHQRTHTGEKPYTCN
DCGKGFTLKNPLIRHQRTHTGEKPYVCSVCGKGFTMKGDLVVHQRTHIAEKPFICSDCGK
GFTVKSQLIVHERTHTGEKPYVCSECGKGFPAKARLIGHQRTHTGEKPYVCSDCGKGFIQ
KGNLIVHQRTHTGEKPYVCNECGKGLSAKRKLVAHLRTHTGEKPYICSECGKGFTVKSTL
GTHQQTHTGEKPYKCNECGKAFRKKTCLIRHERFHSGKTFACTECGKFSLYKNDLITHQR
IHTGEKPYECSECGKTFTTKSGLSVHQRKHTEEKPYGCSECEKAFAHLSILDKHKRIHR
Download sequence
Identical sequences ENSTTRP00000004311 ENSTTRP00000004311

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]