SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000004421 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000004421
Domain Number 1 Region: 17-110
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.19e-24
Family Ubiquitin-related 0.0000276
Further Details:      
 
Domain Number 2 Region: 543-588
Classification Level Classification E-value
Superfamily UBA-like 0.000000000000236
Family UBA domain 0.0014
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000004421
Domain Number - Region: 209-259
Classification Level Classification E-value
Superfamily ARM repeat 0.000213
Family Mo25 protein 0.032
Further Details:      
 
Domain Number - Region: 399-452
Classification Level Classification E-value
Superfamily XPC-binding domain 0.0327
Family XPC-binding domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000004421   Gene: ENSTTRG00000004696   Transcript: ENSTTRT00000004691
Sequence length 592
Comment pep:novel genescaffold:turTru1:GeneScaffold_2718:435094:486998:-1 gene:ENSTTRG00000004696 transcript:ENSTTRT00000004691 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAENGESGGPPSSQDSAAAAEGAGAPAAAAAAASTEPKIMKVTVKTPKEKEEFAVPENSS
VQQFKEEISKRFKSHTDQLVLIFAGKILKDQDTLSQHGIHDGLTVHLVIKTQNRPQDHSA
QQTNTSGSNATASSAPNSNSTSGSATSNPFGLGGLGGLAGLSSLGLNTTNFSELQSQMQR
QLMSNPEMMVQIMENPFVQSMLSNPDLMRQLIMANPQMQQLIQRNPEISHMLNNPDIMRQ
TLELARNPAMMQEMMRNQDRALSNLESIPGGYNALRRMYTDIQEPMLSAAQEQFGGNPFA
SLVSNTSSGEGSQPSRTENRDPLPNPWAPQASQSSSASSGTTSAVGGTSSGAASGTAGQS
STVPNLGPGVGASMFNTPGMQSLLQQITENPQLMQNMLSAPYMRSMMQSLSQNPDLAAQM
MLNNPLFAGNPQLQEQMRQQLPTFLQQMQNPDTLSAMSNPRAMQALLQIQQGLQTLATEA
PGLIPGFTPGLGALGSTGGSSGTSGSNSASGENPSPTAGTTESGHQQFIQQMLQALAGVN
PQXXXXXVRFQQQLEQLSAMGFLNREANLQALIATGGDINAAIERLLGSQPS
Download sequence
Identical sequences ENSTTRP00000004421 ENSTTRP00000004421

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]