SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000004479 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000004479
Domain Number 1 Region: 297-352,383-435
Classification Level Classification E-value
Superfamily Supernatant protein factor (SPF), C-terminal domain 4.05e-31
Family Supernatant protein factor (SPF), C-terminal domain 0.0019
Further Details:      
 
Domain Number 2 Region: 8-78
Classification Level Classification E-value
Superfamily Acyl-CoA binding protein 3.53e-16
Family Acyl-CoA binding protein 0.0042
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000004479
Domain Number - Region: 151-215
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0628
Family beta-sandwich domain of Sec23/24 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000004479   Gene: ENSTTRG00000004752   Transcript: ENSTTRT00000004753
Sequence length 436
Comment pep:novel genescaffold:turTru1:GeneScaffold_3039:42306:73901:-1 gene:ENSTTRG00000004752 transcript:ENSTTRT00000004753 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FFKEKDGKAFHPTYEEKLKLVALPKQVLMGPYNPDTCPEVGFFDVLGNDRRREWAALGNM
SKEDAMVEFVKLLNRCCHLFSTYVASHKIEKEEQEKKRKEEEERRRREEEERERLQKEEE
KRRQEEEERLRREEEERRRIEEERLRLEQQKQQIMAALNSQTAVQFQQYAAQQYPGNYEQ
QQILIRQLQEQHYQQYMQQLYQVQLAQQQAALQKQQEVAVAGASLPTSSKVNTTTPSDMM
SVNGQAKTHTDNSEKELEPEAAEEALENGPKESLPVIAAPSMWTRPQIKDFKEKIRQDAD
SVITVGRGEVVTVRVPTHEEGSYLFWEFATDNYDIGFGVYFEWTDSPNTAVSVHVSESSD
DDEEEEENISSEEKAKKNANKPLLDEIVPVYRRDCHEEVYAGSHQYPGRGVYLLKFDNSY
SLWRSKSVYYRVYYTR
Download sequence
Identical sequences ENSTTRP00000004479 ENSTTRP00000004479

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]